KEGG   Thiocystis violascens: Thivi_0320Help
Entry
Thivi_0320        CDS       T02138                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tvi  Thiocystis violascens
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Thivi_0320
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Thivi_0320
Enzymes [BR:tvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Thivi_0320
Two-component system [BR:tvi02022]
 CheA family
  CheA-CheYBV
   Thivi_0320
Bacterial motility proteins [BR:tvi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Thivi_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
332721..333839
Genome map
AA seq 372 aa AA seqDB search
MAAVKVFIVDDSAVVRQVLTEQLNAIGGIQVIGSARDPIFAQKMLEKEWPDVIVLDIEMP
RMDGITFLRQLMKERPTPVIICSTLTERGAEVTMQAMNAGAVDIIAKPKIGLRQFLEESK
TLLGDAIKGASHARMDKLGSARRLAPAGASAAAPKLTAEAVVAERGFKPLAETTDRVVAI
GTSTGGTQALEYVLTRLPRTAPGIVVVQHMPGQFTAAFAARLNGLCGIEVREARNGDRVI
AGLALIAPGTDHLLLRRSGAQYRVEVKNGPLVSRHRPSVDVLFRSTAQSAGPNAVGIIMT
GMGDDGARGMLEMHEAGAFTVAQDELTCIVYGMPKEAVKLGGVDAVVGLPRIPEMIVQAP
SRQSYLRSVGHA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagtcaaggtctttatcgtcgacgattcggcggtcgtccgccaggtactcacc
gaacagctgaacgcaattggcggtattcaggtgatcggttccgcccgcgaccccatcttt
gcccaaaagatgctggagaaagagtggcccgatgtcatcgtgctcgacatcgagatgccg
cgcatggacggcatcacctttctgcgccaattgatgaaggagcgtccgacgcccgtcatc
atctgctcgaccctcaccgaacgcggcgcggaggtcaccatgcaggcgatgaacgctggc
gcggtcgatatcatcgccaagcccaagatcggtcttcgtcagtttctggaagagtccaaa
accctgctcggcgatgccatcaagggcgcgagtcatgcccggatggacaagttgggttcg
gcgcgacgccttgctccggcgggggcgtcggcagcggcccccaagctgaccgcggaggcg
gtggtcgcggagcgcggtttcaagccgctggccgagaccaccgatcgggtggtcgcgatc
ggaacctccaccggtggcacccaggcgctcgaatacgtcctcacccggctgccccgcacc
gcgcctggcatcgtcgtggttcagcacatgccggggcaattcacggcggcctttgccgcg
cgtctgaatggattgtgcgggatcgaggtccgcgaggcgcgcaatggcgaccgcgtgatc
gccgggctggcgctgatcgcgccgggaaccgaccatctgctgctgcggcgcagcggcgcc
cagtatcgggtcgaggtcaagaacggcccgctggtcagtcgtcaccgtccctcggtggat
gtactgtttcgttcgaccgcgcaatcggccggtccgaacgcggtcggcatcatcatgact
ggcatgggcgacgacggcgcgcgcgggatgctggagatgcacgaggccggtgccttcacg
gtcgcccaggacgagctgacctgcatcgtttacggaatgcccaaggaggcggtgaagctc
ggcggagtcgacgccgtggtgggactgccgcggattccggagatgatcgtgcaggcacct
tcccggcagagctatctccggtctgtcgggcacgcttga

DBGET integrated database retrieval system