KEGG   Thiocystis violascens: Thivi_0381Help
Entry
Thivi_0381        CDS       T02138                                 

Definition
(GenBank) chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
tvi  Thiocystis violascens
Pathway
tvi02020  Two-component system
tvi02030  Bacterial chemotaxis
Module
tvi_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Thivi_0381
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Thivi_0381
Enzymes [BR:tvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Thivi_0381
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Thivi_0381
Two-component system [BR:tvi02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Thivi_0381
Bacterial motility proteins [BR:tvi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Thivi_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AFL72450
UniProt: I3Y632
Position
392125..393198
Genome map
AA seq 357 aa AA seqDB search
MALRVVVVDDSGFFRRRIVEILNADIGIEVVGTAANGLEGIEVVKRLNPDVVTMDIEMPV
MDGITAVRRIMAESPRPVLMFSTLTTEGARATLDALDAGAMDFLPKRFSEIAKDEDAAKV
MLRRRVRALARTRHQALSRPAARERPSTHEPELTAPSARRAPVSATPLHSLRAVLIGTST
GGPVALQEVLKVLPKSFPLPIILVQHMPASFTPAFAERLNNLCQIEVREAVSGDVLKPGC
ALLAPGGQQLVLEGGAQTRVRIQENPPGTIYKPSVDITFQSAVTALKSQVLAVVLTGMGA
DGREGTRALQGQGAHVWAQDAASSVVFGMPAAVIDAGLADHVLALKDVGPALVKGFC
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcgagtcgtcgtggtcgatgattccggattttttcggagacggatcgtcgaa
attctcaacgccgacatcgggatcgaagtggtcggaaccgccgccaacggtctggagggg
atcgaggtcgtcaagcgtctgaacccggacgtagtgaccatggatatcgagatgcccgtg
atggatgggattaccgcggttcgtcgtatcatggcggaatccccaaggccggtcctgatg
ttctcgacgctgacgaccgagggcgccagggcgaccctggatgcgctggatgcgggtgcg
atggattttctccccaaacgcttcagtgaaatcgccaaggacgaggatgccgccaaggtg
atgctgcgccgtcgtgttcgtgcattggcccgcacccggcatcaggcgctcagccgtccc
gcggcccgggagcggccgtcgacgcatgagcccgaactgacggcaccctccgcgcggcgg
gcgccggtcagcgccactccgctgcattcattgcgcgctgtgcttatcggtacctcgacc
ggtggtccggtcgcccttcaggaagtgctgaaggtactgccgaaaagttttcccttgccg
attatcctggtccagcacatgcccgcgagcttcaccccggcatttgcggagcgtctgaac
aatctctgccagatcgaggtccgcgaggcggtttcgggtgatgtgctgaaacccggctgc
gcgctccttgcgccaggcggtcagcaactggtgctggaagggggggcgcagacccgtgtc
aggatccaggaaaatccgccgggaaccatttacaagccgagcgtcgatatcacctttcaa
tcggcggtcactgcgttgaaatcccaggtgctcgccgtggtgttgaccggcatgggggcc
gatggccgcgaagggacacgggcattgcaagggcagggcgcccatgtctgggcacaggat
gcggccagttcggtcgtgttcggcatgccggcggcggtgatcgatgcgggtcttgcggat
catgtcctggcgctgaaggatgtggggccggcactggtaaagggtttctgctga

DBGET integrated database retrieval system