KEGG   Thiocystis violascens: Thivi_0482Help
Entry
Thivi_0482        CDS       T02138                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tvi  Thiocystis violascens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495702..496370
Genome map
AA seq 222 aa AA seqDB search
MDPGIGMTSLRTRKRLILRLREAGIHAPEVLTAMRDLPRHLFVDEALASRAYEDSALPIG
HGQTISQPYTVARMTQSLLERVRPDTVLEIGTGSGFQTAVLASMVRRVYSVERVRELLDR
ARQRLSALKQRNIRFLLGDGSKGWLDYAPYDGILVTAAPRGVPRLLAEQLAPGGVMVLPI
GDAARQMLVRVTRVGDGFEQEMLEAVSFVPLLMGISDSVSEG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggatccagggatcgggatgacctccctgcgcacacggaaacggttgattctccgtctg
cgcgaggccgggattcacgcgccggaggtgctgacagcgatgcgggatctgccgcggcat
ctgtttgtggacgaggcgctggcgagccgggcctacgaagattcggcgctgccgatcggt
catggtcagaccatctctcagccctataccgtcgcgcgcatgacgcaatcgctgttggaa
cgcgtcaggccggatacggtgcttgaaatcggcacgggttcgggttttcaaaccgccgtg
ctcgcctccatggtgcgccgtgtctacagtgtggaacgcgtgcgcgaattgctggatcgc
gcgcggcaacggttgagtgctctcaaacagcgaaatattcgttttctgcttggcgatggg
tcgaagggctggcttgactatgcgccctacgatggcatcctggtgaccgccgcgccacgc
ggagtgccgcggctgctggccgagcaactggcgccgggaggagtcatggtgctgccgatc
ggggatgccgcgcggcagatgctggtgcgagtcaccagggtcggggatggattcgagcag
gagatgctggaagcggtgagttttgtgcccttgctgatgggaatttccgattcggtatcg
gaaggataa

DBGET integrated database retrieval system