KEGG   Thiocystis violascens: Thivi_0672Help
Entry
Thivi_0672        CDS       T02138                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tvi  Thiocystis violascens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thivi_0672
Enzymes [BR:tvi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Thivi_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
717544..718155
Genome map
AA seq 203 aa AA seqDB search
MIGQLRGVILSKHPPQLLLDVGGVGYEVDAPMTTFYDLPAVGETVTLITHFVVREDAQIL
YGFLHERDRALFRALLKVTGVGARMALAILSGMDAARFAQCVEQDDSDALTRIPGIGKKT
AQRLVIEMRDRLDGLVGGVVRMPGGPASAPGNARDRMLADAVSALEALGYRPPDASRMAR
AADDGARTAEEIIRAALRSINPA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccaactccgcggtgtgatcctctccaagcaccctccgcaattgctgctggac
gtgggcggggtcggctatgaggtcgatgcccccatgacgaccttctacgatctgccggcg
gtgggcgagacggtgacgctcatcacccattttgtggtgcgcgaggatgcgcaaatcctc
tacggttttctccacgaacgcgaccgcgcgctttttcgcgccctgctcaaggtcaccggg
gtgggcgcgcgcatggcgctggcgatcctctccggcatggacgccgcgcgcttcgcccaa
tgcgtcgagcaggacgacagcgatgccctgacgcgcatccccggcatcggcaagaagaca
gcgcagcgtctggtgatcgagatgcgcgaccggctcgacggtctcgtcggcggtgtcgtc
agaatgcccggcggccccgcctcggcaccgggcaacgcgcgggaccggatgctcgcggac
gcggtgagcgcgctggaggcgctcggctatcggccgccagacgctagccgcatggcgcgc
gccgccgacgatggcgccagaaccgccgaggagatcattcgcgccgccctgcggtcgatc
aatccggcctga

DBGET integrated database retrieval system