KEGG   Thiocystis violascens: Thivi_0916Help
Entry
Thivi_0916        CDS       T02138                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tvi  Thiocystis violascens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thivi_0916
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thivi_0916
Enzymes [BR:tvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thivi_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(997551..998387)
Genome map
AA seq 278 aa AA seqDB search
MSRIAQRFEQLRGRGRTALIPFVTAGDPAPEVTVPLMHAMVAAGADLVELGVPFSDPMAD
GPVIQRATERALAKGVSLTHVLGMVREFRERDTETPVVLMGYLNPIEVMGYDAFSRQAQA
AGVDGALIVDLPPEEGHDLIETMKSHGLDLVYLLAPTSTESRIARIGGVASGFVYYVSVK
GVTGAGHLDTEAVAGQVRLIKSLIPLPVGVGFGIKDPETAASVARGADAVIVGSAIVSRI
ETLAETPERIPETIADFLAGLRNAIDAVDASPEPRTAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggattgcgcaacgtttcgagcaactgcgcgggcggggacgcaccgcgctcatc
cccttcgtcaccgccggcgatcccgcgcccgaggtcaccgtcccactgatgcacgcgatg
gtcgcggcgggcgcggatctcgtcgaactgggcgtgccgttttccgaccccatggccgat
ggtccggtgatccagcgggcgaccgagcgggcgcttgcgaagggcgtctcgctgacgcat
gtgctcgggatggtccgggaattccgtgagcgggataccgaaactccagtcgtcctcatg
ggctatctgaaccccatcgaggtcatgggctacgacgccttctcgcgccaggcccaagcg
gcgggcgtggatggcgcgctgattgtcgacctgccgccggaggaggggcacgatctgatc
gagaccatgaaatcgcatggcctggatctggtctatctgctcgccccgacctccaccgaa
tcgcgcatcgcgcggatcggcggcgtcgcctccggcttcgtctactatgtctcggtcaaa
ggcgtgaccggtgccggtcatctggataccgaggctgtcgccggacaggtgcgtctgatc
aaatccctgatcccgctgcccgtgggggtcggattcgggatcaaggatccggagaccgcc
gccagcgtggcgcggggcgcggatgcggtgatcgtcggcagcgccatcgtcagccgcatc
gagacgctggccgagaccccggagcgcattcccgagaccatcgccgactttctggccgga
ctgcgcaacgcgatcgacgccgttgacgcctcgcccgaaccacggaccgcggagtaa

DBGET integrated database retrieval system