KEGG   Thiocystis violascens: Thivi_0917Help
Entry
Thivi_0917        CDS       T02138                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tvi  Thiocystis violascens
Pathway
tvi00260  Glycine, serine and threonine metabolism
tvi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tvi01100  Metabolic pathways
tvi01110  Biosynthesis of secondary metabolites
tvi01130  Biosynthesis of antibiotics
tvi01230  Biosynthesis of amino acids
Module
tvi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thivi_0917
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thivi_0917
Enzymes [BR:tvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thivi_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFL72952
UniProt: I3Y7I4
Position
complement(998384..999634)
Genome map
AA seq 416 aa AA seqDB search
MATNADNIRASRTEPGRGPAYDLPNSHGHFGPYGGMFVPETLMHPLEELRAAYAACLADP
NFQIEMDADLRDYVGRPSPLYHAERWSRELGGAQIYLKREDLNHTGAHKVNNTIGQALLA
RRMGKTRIIAETGAGQHGVASATVAARLGLECVVYMGEVDIARQEANVYRMRLLGARVVP
VTSGSRTLKDALNEAMRDWVTNVDNTFYIIGTVAGPHPYPMMVRDFQAVIGREARAQILE
RAGRLPDALVACVGGGSNAIGLFYPFIEDREVAIYGIEAAGEGIATGHHAAPLNAGRPGV
LHGNRTYLMEDANGQIIETHSISAGLDYPGVGPEHAWLKDSGRAQYDAVTDDEALAAFHH
LTRTEGIIPALESSHALAYAHKLAPTLRQDQIILVNLSGRGDKDMHTVALHDGLVL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaaacgccgataatatccgtgcatcgcgcacggagccgggtcgcgggccggcc
tacgatctgccgaacagccatggtcatttcggaccctatggcgggatgttcgtccccgag
acgctgatgcatccgctggaggaactgcgcgcggcctatgcggcctgtctcgccgatccg
aattttcagatcgagatggacgctgacctgcgcgactatgtaggtcgtccgtcgccgctc
tatcatgccgagcgctggagccgcgagctgggcggcgcccagatttatctgaagcgcgag
gatctcaatcacaccggcgcgcacaaggttaacaacaccatcggtcaggcgttgctcgcg
cggcgcatgggcaagacccgcatcatcgccgagaccggcgccggtcagcatggcgtcgcg
tccgcgaccgtcgccgcccgtctcgggctcgaatgcgtggtctatatgggcgaggtcgac
atcgcgcgccaggaggccaacgtctaccggatgcgtctgctcggcgctcgcgtcgtgccc
gtcacctccggctcgcggaccctcaaggacgcgctcaacgaggcgatgcgcgactgggtg
accaacgtcgacaacaccttctacatcatcggcaccgttgccggaccgcatccctatccg
atgatggtccgcgatttccaggcggtgatcggccgcgaggcacgcgcccagatcctggag
cgcgccgggcgtctgccggatgcgctggtcgcctgcgtgggcggcggatccaacgccatc
gggctgttttatcccttcatcgaggatcgcgaggtcgcgatttacggcatcgaggcggcg
ggcgaggggatcgcgaccggtcatcatgccgcgccgctgaacgccggtcggcccggcgtg
ctgcacggcaaccgcacctatctgatggaagacgcgaacggccagatcatcgagacccac
tccatctcggccgggctcgattatccgggcgtcggtcccgaacacgcctggctgaaagac
agcggacgcgcccagtacgatgcggtcaccgatgacgaggcgctggccgccttccaccat
ctgacccgcaccgagggcatcatccccgcgctggagtccagtcacgcgctggcctacgcg
cacaaactcgcgccgaccctgcgccaggatcagatcatcctggtcaatctgtccggccgc
ggagacaaggacatgcacacggtcgcactgcacgacgggttggttctatga

DBGET integrated database retrieval system