KEGG   Thiocystis violascens: Thivi_1008Help
Entry
Thivi_1008        CDS       T02138                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tvi  Thiocystis violascens
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Thivi_1008
   00240 Pyrimidine metabolism
    Thivi_1008
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Thivi_1008
   03430 Mismatch repair
    Thivi_1008
   03440 Homologous recombination
    Thivi_1008
Enzymes [BR:tvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Thivi_1008
DNA replication proteins [BR:tvi03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Thivi_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1096393..1096824
Genome map
AA seq 143 aa AA seqDB search
MTRIDFYSLEPESRGDRFLLTCRLVERIRAKELRVLIHCPDSEQARHLDRLLWTFRQDSF
LPHGLVGQTDPELTPVLISDDGRPETEHQVLLNLSFEIPDFLDRFERVCELIDHDPNARA
TGRERFRAYRERGYPLEHHRLRL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaatcgatttctacagcctggaaccggagagtcgcggcgaccgctttctcttg
acctgccggctcgtggaacggattcgcgccaaggaactgcgcgtcctcatccactgtccg
gattcggagcaggcgcgccatctggaccgcctgctttggacctttcgccaggacagcttc
ctgccacacgggctggtaggccagaccgatcccgagctaacgcccgtcctcattagcgat
gacggaaggccggaaaccgagcatcaggttctgctcaatctctccttcgagattcctgac
ttcctggaccgtttcgagcgcgtgtgcgagctgatcgaccatgaccccaacgcccgcgcc
accgggcgcgagcgtttccgcgcgtatcgcgagcgtggctatccgctggagcatcatcgg
ctacggctttag

DBGET integrated database retrieval system