KEGG   Thiocystis violascens: Thivi_1274Help
Entry
Thivi_1274        CDS       T02138                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
tvi  Thiocystis violascens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1387798..1389465)
Genome map
AA seq 555 aa AA seqDB search
MSTPAPNQWKEKYLSTLDEIETKEKAWEQIETILRQAVSRLALAAETSDTQMKGQLETLR
SAIRKNATASQIGKLMEDISSSMVRLDQERGDGSDSIKSQLSRLEGNLDKLRVPDGLKQD
TKELRTQLRDALRSNDLKPALDAYSGYVDKLVACLAAPQQDGRDGLFGRFFGRKPAEGIQ
ENPGEPGLAPALALDTRELNVQDASTDAPPAFNQVLFDLLHRLDLPAAVSAQFQSIATLL
HEPPSSDLARRVVADIAELMAKARQHVEQEKKEIETFLSQLTGRLQDLDRYLEDAVGYRG
QSAQQGDAIDKSMSAEVDGIRKSVDEAENIDQLKASIQARLSSIQLHMDARKRLEQDRLK
QADSEIDHLKQALAKVHQESGELRVRLSQERDRALRDALTGLNNRLAYDERITQECERWE
RYGRPTVLSIWDVDHFKRVNDQFGHSAGDNVLKILGNLLNKHTRKSDFIARFGGEEFMLL
LPETDIQTAFEVADKLREFIAAAKFLYRGQPVPVTMSCGLAECVVGDTPESLYRRADTAL
YEAKQGGRNCCRIGD
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcctgctccgaaccaatggaaagaaaaatatctctccactctcgatgaaatc
gagacaaaggaaaaagcctgggaacagatcgaaactatccttcgtcaggcagtctcgcga
ctcgcgctggccgccgagacatccgatacgcagatgaaaggacaactggagactctgcga
agcgcgatccgcaagaacgcgacagccagtcagatcggcaagctgatggaggatatctcc
agttccatggtgcgtctcgaccaggaacgaggagatggcagcgatagtatcaagagtcaa
ttgtcccgactggaaggcaacctggacaaactccgggtgccggatggactgaagcaagac
accaaagaactccgaacgcaattgcgagacgccctgcggagcaacgacctcaaacccgcg
ctggatgcctactcgggttacgtggataaactcgttgcatgtctggccgcgccccagcag
gatggtcgggacggtctgttcggccggttcttcgggcgcaaaccggccgagggcatccag
gaaaatccgggcgagcctggtctggcgcccgccctggctttggatacgcgcgagctgaac
gtccaggatgccagcaccgatgcgccgccggccttcaaccaggttttgttcgatctgctc
catcgtctggatctgcccgcggcagtgtccgcccagtttcagtcgatcgccacgctgctg
catgagccgccatcgtccgatttggcccgccgggtggtggcggacatcgccgaactgatg
gccaaggcgcgtcagcatgtggaacaggaaaaaaaggagatcgagacctttctgtcccag
ctcaccggacgccttcaagatctggatcgctaccttgaggacgcggtcggataccgcgga
caatcggcccaacagggcgatgccatcgataagagcatgtccgccgaggtcgacgggatc
cgcaaatcggtggacgaggccgagaacatcgatcagctcaaggcgtcaattcaggcgcgc
ctgagcagcatccaactccacatggacgcccgcaagcgtctggagcaggatcggttgaaa
caggcggacagcgagatcgatcacctgaagcaggcgctggccaaggtgcatcaggaaagc
ggcgaactacgggtacgcctgagtcaggaacgtgaccgcgccctgcgcgacgccttgacc
gggctcaataaccgtctcgcctatgacgagcggatcacgcaggaatgcgaacgctgggag
cggtatggcagacccacggtgctgagtatctgggatgtcgatcacttcaagcgagtcaat
gaccagttcggtcatagcgccggggacaatgtgctgaagatccttggcaatctgctgaac
aaacatacgcgtaaaagcgattttattgcccgtttcggcggcgaggagtttatgttgctg
ctccccgaaaccgatatccagaccgcgttcgaggtggccgacaagcttcgtgaatttatc
gccgcggcgaagtttctgtaccgcggtcaaccggtcccggtcaccatgtcgtgcggtctg
gccgaatgtgtcgtcggcgataccccggagagcctctaccgccgggcggatacggcgctc
tacgaggcgaaacaggggggacgcaattgctgcaggattggcgactag

DBGET integrated database retrieval system