KEGG   Thiocystis violascens: Thivi_1372Help
Entry
Thivi_1372        CDS       T02138                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
tvi  Thiocystis violascens
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Thivi_1372
   00565 Ether lipid metabolism
    Thivi_1372
   00590 Arachidonic acid metabolism
    Thivi_1372
   00591 Linoleic acid metabolism
    Thivi_1372
   00592 alpha-Linolenic acid metabolism
    Thivi_1372
Enzymes [BR:tvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Thivi_1372
    3.1.1.32  phospholipase A1
     Thivi_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1493832..1494908
Genome map
AA seq 358 aa AA seqDB search
MTNPLSRHRSATLLAAMLGIVPALGAPAFARTPPPGIGDCAAITSDRERLACYDRVSASV
AAAAPDQEPERAAMMAPAASASVASFDKEASTPTSSIDAAWGFAPDSERYTIAFHRPNYL
QFARYSSRPNNAPFQTLFATTQDPDVELDSAEARFQISFKARLWTTENRRFGIWAAYTQQ
SQWQVYNDEVSRPFRENNYMPELMASFRPNVEFGGFHWRLFNFGYTHQSNGRADPISRSW
DRLIAEFGIERGNFALLIRPWYRFEEDEGDDDNPDILDYYGHGDVTAIYKWHGHSFSLMG
RGNLETDKGAAQFSWTTPPLLGPLRGYVQAFTGYGDSLIDYNWKQNAIGIGVTLNDQL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccctttatctcgacaccgctcggcgaccttactcgcggccatgcttgggatc
gtcccagcgctcggcgcgcccgccttcgcgcggaccccgccgccgggcatcggcgactgc
gcggccatcacatccgaccgggagcggcttgcctgctatgaccgcgtcagcgcaagcgtt
gccgccgccgcgccagaccaggaaccggaacgcgccgcgatgatggctccggcggcttct
gcgtccgtcgcctcgttcgacaaggaagcatccaccccgacatcgtcgatcgatgccgcc
tggggcttcgcccccgactccgagcgctacaccatcgccttccatcggcccaattacctg
caattcgcgcgctattccagccggccgaacaatgcacccttccagaccctgttcgcgacg
acccaggatccggacgtggaactagattcggccgaggcgcgatttcagatcagcttcaag
gcgcgcctgtggacgaccgagaatcggcgcttcgggatctgggcggcctacacccagcag
agtcaatggcaggtctacaacgacgaggtatcgcgccccttccgcgagaacaactacatg
cccgagctgatggcgagcttccggcccaatgtcgaattcggcggcttccattggcggttg
ttcaatttcggctatacccaccagtccaacggccgcgccgacccgatctcgcggagctgg
gatcgtctcatcgcggaattcggaatcgaacggggcaatttcgcgctgctgatccggccc
tggtatcgcttcgaggaagacgagggggatgacgacaatcccgacatcctcgactattac
ggccatggcgatgtcaccgccatttacaaatggcacggacacagcttctcgctcatgggt
cgcggcaaccttgaaaccgacaagggcgccgcccagttttcctggacgacgcccccgctg
ctcggcccactgcgcggctatgtccaggcatttaccggttacggggacagcctgatcgat
tacaactggaagcagaacgcgatcggcatcggggtcaccctgaacgaccagctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system