KEGG   Thiocystis violascens: Thivi_1748Help
Entry
Thivi_1748        CDS       T02138                                 

Definition
(GenBank) protein-L-isoaspartate carboxylmethyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tvi  Thiocystis violascens
Brite
Enzymes [BR:tvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Thivi_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_31 MTS Methyltransf_23 CMAS Methyltransf_18 Methyltransf_12 Methyltransf_32 Ubie_methyltran GCD14 PrmA
Motif
Other DBs
NCBI-ProteinID: AFL73722
UniProt: I3Y9Q4
Position
1903010..1903675
Genome map
AA seq 221 aa AA seqDB search
MDNRFDLARFNMIQQQIRPWDVLDEHVLDAMAAIAREAFVPDAYRGLAYADIEIPIGTGT
SMLDPKVVGRLLQALDVRPGEKVLEIGTGTGYVTACLSRLGGRVISVEIDPALAAAARER
LAALKFAGVEVREGDGLAGPIAGGPFEAIAVTGSMPTDASLPMLQDHLSVGGRLFCIVGE
EPVMEALLITRLGGRNFSRETLFETCVPSLAKVVEPESFVF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggataaccgcttcgaccttgcccgtttcaatatgatccagcagcagattcgtccttgg
gacgttctcgacgagcatgtcctggacgcaatggctgcaattgcgcgcgaggctttcgtg
cccgatgcctatcgcgggctggcctacgcggatatcgagatcccgatcggcacggggacg
agcatgctcgacccgaaagtcgtcggccgtctgttgcaggcgctcgacgtgcgacccggc
gagaaggtgctggagatcggtaccggcaccgggtatgtcacggcctgtctgagccggctg
ggcgggcgcgtgatcagtgtcgagatcgacccggcgttggccgccgcggcccgcgaacgg
ctggcggcactgaagttcgcgggcgtcgaggtacgcgagggagatggtctggccggcccc
atcgcgggcggcccgttcgaggcgatcgccgtcacgggttcgatgccgacggacgcctcg
ctgccgatgctccaggatcatctctcggtgggcgggcgtctgttctgcatcgtcggcgaa
gagccggtcatggaggcgctgctgatcacccgactcggcggtcgaaatttcagccgcgag
acacttttcgagacctgcgtgccctccctggccaaggtcgtggagcccgaaagctttgtt
ttttag

DBGET integrated database retrieval system