KEGG   Thiocystis violascens: Thivi_1845Help
Entry
Thivi_1845        CDS       T02138                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tvi  Thiocystis violascens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thivi_1845
Enzymes [BR:tvi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Thivi_1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2008747..2010582)
Genome map
AA seq 611 aa AA seqDB search
MSTAGATPAVDTGGGPDLNQAPNPAPAGPGPSPWDDAVLAAVLMSVDPVGTGGVSLRALA
GPVRDQWLAVMRDLQPEGTPQRRIPLHVSDGRLLGGLDLAATLSAGRPVAELGLLVEAHG
GVVELAMAERIAAGTAARLTMAFDAGEVVLERDGLAMRTPSRFAVVALDEGVGEDEGLLN
ALLDRLAFHLELTYIRVHEAVACPYDADDILEARARLPSVTITEKQIEALCGLALALGIP
SLRASIFACRAACASAALEERTEVADADLAVAGRLVLAPRATQLPPMEPPPDAEPPPPEP
DEPDQEQNQSNEQQEPQELEDQILEATKAAIPAGLLAQLQMGKLRRSRARQTGKAGAVQN
AQTRGRPAGVLCGEPRAGLRLNVVETLRAAAPWQRLRREERERFGQESTRIEVRQDDFRI
TRFKHKSETTTIFVVDASGSSALHRLAEAKGAVELLLADCYVRRDKVALVAFRGQAAEVL
LPPTRSLVRAKRSLAGLPGGGGTPLASGIDLGMILADSVKRRGGTPVLILMTDGRANVAR
DGTGGRTRAGEESLAAARVVRSLEITALVIDTSPRPQQQGRDLAKEMGAVYLPLPHADAN
SLTQAVRATSG
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagccggcgcgactcccgccgtcgacactggcggcgggcctgacctgaatcag
gcacccaacccggccccggccggtcccggaccctcgccctgggatgacgccgtgctggcg
gcggtcctgatgtcggtcgatccggtcggcaccggcggcgtctcgctgcgcgccctggcg
gggccggtgcgcgatcagtggctggcggtcatgcgcgaccttcagcccgaaggcacgccc
cagcggcggattccgctgcacgtctccgacggccgactgctcggcggtctggatctggcc
gcgaccctgagcgccggccgtccggtcgccgaactcggcctgctggtcgaggcccacggc
ggcgtggtcgagctggcgatggcagagcgcatcgccgccggcaccgccgcgcgtctgacc
atggccttcgacgccggcgaggtggtgctggagcgcgacggtttggcgatgcgcaccccg
tcgcggttcgccgtggtcgcgctcgacgaaggcgttggcgaggacgaagggctgctcaat
gccctgctcgatcggctcgccttccatctcgaactgacctatatccgtgtccatgaggcg
gtcgcctgtccctacgacgcagatgacatcctggaggcccgcgcgcggctcccctcggtc
acgatcaccgaaaaacagatcgaggcgctgtgcggtctcgccctggcgctggggattccc
tcgctgcgcgcgtctatcttcgcctgtcgcgccgcctgtgcctccgccgcgctggaagaa
cggaccgaggtcgcggacgcggatctcgcggtcgccggtcgtctggtgctggccccgcgc
gcgacccaactgccgccgatggagccgccgccggacgccgagccgccgccgcccgaaccg
gacgagccggatcaggagcagaaccagtccaacgaacagcaggaaccgcaggaactcgaa
gatcagatcctggaagcgaccaaggccgcgatcccggccggtctgctcgcgcaattgcag
atgggcaagctgcgccgctcgcgggcgcgtcagactggcaaggccggcgcagtccagaac
gcccaaacgcgcggtcgcccggcgggtgtgctgtgcggcgagccgcgcgccggactgcgt
ctgaacgtggtcgaaaccctgcgcgccgccgccccctggcagcgtctgcgccgggaggaa
cgcgagcgcttcggtcaggagtcgacccgtatcgaggtgcgtcaggacgacttccgcatc
acccgcttcaagcacaagtccgaaaccaccaccatcttcgtcgtcgacgcctccggctcc
tcggccctgcatcgtctggccgaggccaagggcgcggtcgagctgctgctggcggactgc
tatgtgcgtcgcgacaaggtcgcgctggtcgcctttcgcggtcaggccgccgaggtgctg
ctaccgccgacccgctcgctggtgcgggccaaacgcagtctcgccgggctgccgggcggg
ggcggcacgccgctggcgtccggcatcgatctcgggatgatcctggccgactcggtcaag
cgtcgcggcggcacgccggtgctgatcctcatgaccgacgggcgggcgaacgtcgcgcgc
gacggcaccggcggacggacccgtgccggcgaggaatcgctggcggcggcgcgggtggtg
cgttcgctggagatcacggcgttggtcatcgacacctcgccgcgtccgcagcaacagggg
cgcgatctggcgaaagagatgggcgcggtctatctgccgctgccccacgcggacgccaac
tcgctgacgcaggcggtgcgggcgacgtcgggttaa

DBGET integrated database retrieval system