KEGG   Thiocystis violascens: Thivi_1846Help
Entry
Thivi_1846        CDS       T02138                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tvi  Thiocystis violascens
Pathway
tvi00860  Porphyrin and chlorophyll metabolism
tvi01100  Metabolic pathways
tvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thivi_1846
Enzymes [BR:tvi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Thivi_1846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 Sigma54_activat AAA_16 AAA_29 DUF815 AAA AAA_30
Motif
Other DBs
NCBI-ProteinID: AFL73817
UniProt: I3Y9Z9
Position
complement(2010579..2011607)
Genome map
AA seq 342 aa AA seqDB search
MSIPFPFSAVVAQEEMKRSLLIAAIDPSIGGVLVFGDRGTGKSTAIRGLAALLPKMRAVD
CTYNCDPEAGDDALCADCRTNRAKKGPLKSRQVPVPVVDLPLGATEDRVIGALDLERALT
KGEKAFEPGLLARAHRGFLYIDEVNLLEDHLVDSLLDVAASGENLVEREGLSIRHPARFV
LVGSGNPEEGELRPQLQDRFGLSVEVKTPQDLPTRIKVVRLRDEFERDPSAFVVKWKGKD
GKVRRSIEKARALLPTVTVPDATLEDAGRLCIKLGTDGLRGELTLIRAARALAALLGDTE
VTQSHLKSIATSALRHRLRRDPLDESGSTSRVERAVGELFGA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcccgtttccgttttcagccgtcgtcgcccaggaggagatgaaacgctccctg
ttgattgcggccattgacccgtcgattggcggggttcttgtgtttggcgaccggggcacc
ggtaagtccacggcaattcgtggactcgccgcgctcctgccgaagatgcgcgcggtcgat
tgcacctataactgcgacccggaggccggcgacgatgccttgtgcgccgactgccgcacc
aatcgcgccaagaaaggaccgctgaaaagccgtcaggtgccggtgccggtggtcgatctc
ccgctcggtgccaccgaggaccgggtcatcggcgcgctggatctggagcgtgccctgacc
aagggcgaaaaggcgttcgagccgggtctgctggcgcgtgcccatcgcgggttcctctat
atcgacgaggtcaatctgctcgaagaccatctggtcgactcgctgctcgacgtcgccgcg
tccggcgagaatttggtcgagcgcgagggtctgagtatccgtcacccggcacgcttcgtg
ctagtcggctcgggcaatccggaggagggcgaactgcggccccagcttcaggaccgtttc
ggtctctcggtcgaggtcaagaccccacaggatctgcccacccgtatcaaggtggtgcgt
ctgcgcgatgagttcgagcgcgatccctccgccttcgtggtcaagtggaaaggcaaggac
ggcaaggtccgccgttcgatcgagaaggcgcgcgcgctgctgccgaccgtgaccgtcccg
gatgcgacccttgaagacgccggacggctctgcatcaagctcggcaccgacggtctgcgc
ggcgagctgaccctgatccgtgccgcgcgcgcgctcgctgccctgctgggcgacaccgaa
gtgacacaatcgcatctgaaatcgatcgccacctcggccctgcggcaccgtctgcgccgc
gatccgctcgacgaatccggttccaccagtcgggtcgagcgcgcggtcggggagctgttt
ggcgcatga

DBGET integrated database retrieval system