KEGG   Thiocystis violascens: Thivi_2027Help
Entry
Thivi_2027        CDS       T02138                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tvi  Thiocystis violascens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tvi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2205240..2207540)
Genome map
AA seq 766 aa AA seqDB search
MDTRTSHPFALSGVEGFAPVEAEDLLARLRAWADAGALRALDLALTRFIHRHGPETDTAV
LLAVALTSERNGHGHVCLDLAGARERPDALLTRLRDDVDTAAEVRADLSALLRGLTLADW
VGRLSRSPAVHNRLDRDATDDAASPLVLEGTPARPLLYLRRYWRYESRILDGIRARLDQR
LELPETDLRALLDALFVVDQDAASDPCDWQKIACALAARSAFAIVTGGPGTGKTTTVVRL
LALLQGLAIGRGQPPLRIRLAAPTGKAAARLNESIAARVADLPLDAVPNGEQVRREIPTE
VTTLHRLLGSIPDSRHFRHHAGHPLPADLVVVDEASMVDVEMMARLLEALRPDARLILLG
DKDQLASVEAGAVLGDLCQRARAAHYLPVTRDWLRRVTGATIPDTYLDDAGEPLDQAIVM
LRKSYRFKPEGGIGALAALVNDDRRHDDTPERQPPTARLSAVLSLFERQRSVSDGKLGRI
DAIQLRDTGSPEFAALVRDGYRAYLTRMRDEDPGDDATRDALDRWARAVLKAQEGFQLLT
ALRQGPWGVEGLNRRIVEVLKDAGLLSGGDALGTAGADRHWFAGRPVLVTRNDYGLHLMN
GDIGITLALPLAPRGVEGPALSGVAGPVLSGVAGPVLSGVEGAELGGQEIGARRRVLRVA
FPAGDGSGGIRWILPSRLQAVETVFAMTVHKSQGSEFDHTVLILPDTSNPVLTRELVYTG
ITRSRHAFTLLYREPSVLGDALERRVRRVSGIGLSRGQTLDECNDA
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggacacccggacgtcccatccgtttgccctgagcggagtcgaagggtttgcgcctgtc
gaggccgaggatctgctcgcccgtctgcgcgcctgggcggatgccggcgcgctgcgcgcg
ctggatctggccctgacccgcttcattcatcgacacggaccggagaccgacacggcggtg
ctgctcgctgtcgccctgaccagcgagcgcaatggacacggccatgtctgtctcgatctt
gccggcgcgcgggagcgtccggacgccctgctcacccgactgcgcgacgatgtggacacc
gccgccgaggtgcgtgccgacttgagcgcccttctgcgcggactgacgctggcggactgg
gtcggacgcctgagccgcagcccggcggtccacaaccggctggaccgcgacgccaccgac
gacgcggcatcccccctcgtcctggaaggcacgcccgcgcgaccgctgctctatctccgg
cgctactggcggtacgagtcgcgcatcctcgacggcatccgcgcgcgtctcgaccagcgg
ctcgaactgccggaaacggacctgcgcgcgctgctcgacgcgctgttcgtcgtcgaccag
gacgcggcgtccgatccctgcgactggcaaaagatcgcctgcgcgctggcggcccgcagc
gccttcgccatcgtcaccggcggtccgggcaccggtaagaccaccactgtggtgcgtctg
ctggcgctgttgcagggcttggccatcgggcgcggccagccgccgctgcgcatccgtctg
gccgcgcccaccggcaaggccgccgcgcgtctgaacgaatccatcgccgcgcgggtggcg
gacctgccgctcgacgccgttccgaatggcgaacaggttcgccgcgagattcccaccgag
gtgacgaccctgcaccggctgctcggctcgatcccggacagcaggcatttccgccatcat
gccggccatccgctcccggccgatctggtggtggtcgacgaggcatcgatggtggacgtg
gagatgatggcccgtctgctggaggcgttgcgtcccgatgcgcgcctgatcctgctgggc
gacaaggaccaactggcctcggtggaggcgggcgccgtgctgggcgatctctgtcagcgc
gcgcgcgccgcgcactatctcccggtcacccgcgactggctgcgccgggtcacgggcgcg
accattcccgacacgtacctcgacgacgccggcgagccgctagatcaggctatcgtcatg
ttgcgcaagagttatcgcttcaagcccgaaggcggcatcggggcgctcgccgcgctggtc
aacgacgatcgacgtcacgacgatacaccggagcgccagccgccgaccgcgcgtctgagc
gccgtgctgagtctgttcgagcgccagcggagcgtcagcgacgggaaactgggccggatc
gacgccatccaactgcgcgacacgggtagcccggaattcgccgccctggttcgcgacggc
tatcgcgcctatctgacccggatgcgcgacgaggatccgggcgacgacgccacccgcgac
gccttggatcggtgggcgcgcgccgtcctcaaggcgcaggaaggattccagttgctcacc
gcgctgcgtcagggaccgtggggcgtggaagggctgaaccgacggatcgtcgaggtgctc
aaggacgccggattgctgagtgggggcgacgccctcgggacggcgggcgcggatcgtcac
tggttcgccggccgcccggtgctggtcacccgcaacgactatggcctgcacctgatgaac
ggcgacattggcatcacgctcgcgctgccgctggccccgcgcggcgtcgaagggcctgcc
ctgagtggcgtcgcagggcctgtcctgagcggagtcgcagggcctgtcctgagcggagtc
gaaggagcggagcttggcggtcaggagattggggcaagacgtcgtgtgttgcgcgtggcc
tttcccgccggcgacggttccggcggcatccgctggatcctgcccagccgtctgcaagcg
gtggagaccgtctttgccatgacggtgcacaaatcacagggctcggaattcgatcacacc
gtgctcattctgccggatacctcaaatccggtcctcacccgcgagttggtctataccggt
atcacccgttcgcgacacgccttcacgctgctctatcgcgaaccgtccgtgctgggcgat
gcgctggaacgccgggttcggcgcgtgagtgggatcggtctttccaggggacagacgctc
gatgaatgcaatgacgcttga

DBGET integrated database retrieval system