KEGG   Thiocystis violascens: Thivi_2151Help
Entry
Thivi_2151        CDS       T02138                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tvi  Thiocystis violascens
Pathway
tvi00620  Pyruvate metabolism
tvi00630  Glyoxylate and dicarboxylate metabolism
tvi01100  Metabolic pathways
tvi01110  Biosynthesis of secondary metabolites
tvi01120  Microbial metabolism in diverse environments
tvi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Thivi_2151
   00630 Glyoxylate and dicarboxylate metabolism
    Thivi_2151
Enzymes [BR:tvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Thivi_2151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFL74101
UniProt: I3YAT3
Position
2353635..2355827
Genome map
AA seq 730 aa AA seqDB search
MIERLETGGLKVAKPLYDLVSNEIAPGTGIAPDDFWRDFGAILSELAPRNRELLARRDAL
QTQLDAWHRERRGQQLDLDAYRAYLSEIGYLVPEGPDFLVSTTNVDPEIAAIAGPQLVVP
LSNARYALNAANARWGSLYDALYGTDAIPEEDHLKRGHDFNPERGAAVVARAAAFLDATV
PLNRGSYGDACGFKLEQGKLVVCLPDNSQTMLTDPAQFIGYRGSPEQVSAILLVHHGLHI
EIQIDREHAIGRESPSGIADILLESAVTCIQDCEDSVAAVDTEDKVGVYRHWLGLMKGDL
TVQFSKGGRMVERAMEPDRNYIRLGGGTLAMPSRALMLVRTVGHLMTTDAVLDAAGQEVP
EGMLDAMITVLCALHDVHPDVGARRNSRAGSVYLVKPKLHGPEEVQLAVDLFARVEAALG
LPVNTVKIGIMDEERRTTVNLKECIRVARERIIFINTGFLDRTGDEIHSGMEAGPVPRKG
DMKRQPWLLAYEDWNVDVGLACGLPGHAQIGKGMWTMPDEMRAMLASKIAHPQAGANCAW
VPSPTAATLHAIHYHQVDVAEVQAELARGGRRASLDDLLQVPTVLDPAWTAEEIQQELDN
CCQGILGYVVRWIDQGVGCSKVPDIANVGLMEDRATLRISSQQVANWLHHGVVSRERVLE
TLQRMAGVVDGQNAGDPCYRPMAPGFDGIAFEAARELIFQGRAAPNGYTEPRLHAMRRRR
KQLDGTRADS
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacgactggagaccggcggcctcaaggtcgccaaacccttgtatgacctggtc
agcaacgagatcgctccaggaaccgggattgccccggacgatttctggagagatttcggc
gcaatcctgagcgagcttgcgccgcgcaatcgcgagctgctcgcccggcgggacgcgcta
cagacgcagctcgacgcctggcatcgcgagcgccgcggccagcaattggatctggacgcc
tatcgcgcctatctgtccgagattggctatctggttcccgagggaccggatttcctggtc
agcaccaccaatgtcgacccggaaatcgccgcgattgccggcccccagctcgtggtgccg
ctgagcaatgcgcgctatgccctgaacgcggccaatgcgcgctggggcagtctctacgac
gcgctctatggaaccgatgcgattccggaggaggatcatctcaagcgcggtcacgacttc
aaccccgagcgcggggcggcggtggtcgcgcgcgccgcggcctttctggacgcgaccgtc
ccgctcaatcgcggctcctacggcgatgcgtgcggattcaagctcgaacagggcaagctg
gtcgtctgtctccccgataacagtcagaccatgctgacggatccggcgcaattcatcggc
taccgcggcagtccggaacaggtttcggccattctgctcgtccatcatggactgcatatc
gagatccagatcgaccgcgagcacgccatcggcagggagagcccgtccgggatcgcggac
atcctgctggagtccgccgtgacctgcattcaggactgcgaggactcggtcgccgccgtc
gataccgaggacaaagtcggcgtgtatcgccactggctcggcttgatgaaaggcgatctg
accgtgcagttcagcaagggcggccggatggtcgaacgcgcgatggaacctgatcgcaac
tatatccggctcggcggcggcaccttggccatgcccagccgcgcgctcatgctggtgcgc
acggtcggccatctgatgaccaccgacgccgtgctcgacgccgcgggccaggaggtgccg
gaaggtatgctcgacgccatgatcacggtcctgtgcgcgctgcacgacgtgcaccccgat
gtcggcgcgcggcgcaactcgcgcgccggcagcgtctacctcgtcaagcccaagctgcac
ggacccgaggaggtccagcttgccgtcgacctcttcgcgcgcgtcgaggcggccttgggt
cttcccgtcaacacggtcaagatcggtatcatggacgaggagcgtcgcaccacggtaaac
ctcaaagaatgcatccgggtcgcccgcgagcggatcatcttcatcaataccggttttctc
gaccgcaccggcgacgagattcatagcggcatggaagccggtccggtgccgcgcaagggc
gacatgaagcgccagccctggctcctggcctacgaggactggaatgtggatgtgggtctg
gcctgcggcctgcccggacacgctcagatcggcaagggcatgtggaccatgccggacgag
atgcgcgccatgctcgcgagcaagatcgcgcatcctcaggccggcgccaactgcgcctgg
gtgccctcgccaaccgccgcgaccctgcatgccatccactatcatcaggtcgacgtggcc
gaggttcaggccgaactggcacggggcgggcgccgcgccagtctggacgatcttctgcag
gttccgacagtgctcgatccggcctggaccgccgaggaaatccagcaggaactggacaac
tgctgtcagggtattctgggttatgtggtgcgctggatcgatcagggcgtgggctgttcc
aaggtgccggacatcgcgaacgtaggtctgatggaagaccgcgcgaccctgcgcatttcc
agtcagcaggtcgccaactggctgcatcatggggttgtcagtcgggaacgggtgctggaa
acgctgcaacgcatggcgggcgtggtggacggtcagaatgccggcgatccgtgctaccgg
cccatggcgcctggcttcgacggcatcgccttcgaggccgcccgcgagctgattttccag
ggccgagcggccccgaacggctataccgaaccccggctgcatgccatgcgccgacgacgc
aagcaattggatggcacgcgagcggattcctga

DBGET integrated database retrieval system