KEGG   Thiocystis violascens: Thivi_2151Help
Entry
Thivi_2151        CDS       T02138                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tvi  Thiocystis violascens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tvi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tvi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tvi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2353635..2355827
Genome map
AA seq 730 aa AA seqDB search
MIERLETGGLKVAKPLYDLVSNEIAPGTGIAPDDFWRDFGAILSELAPRNRELLARRDAL
QTQLDAWHRERRGQQLDLDAYRAYLSEIGYLVPEGPDFLVSTTNVDPEIAAIAGPQLVVP
LSNARYALNAANARWGSLYDALYGTDAIPEEDHLKRGHDFNPERGAAVVARAAAFLDATV
PLNRGSYGDACGFKLEQGKLVVCLPDNSQTMLTDPAQFIGYRGSPEQVSAILLVHHGLHI
EIQIDREHAIGRESPSGIADILLESAVTCIQDCEDSVAAVDTEDKVGVYRHWLGLMKGDL
TVQFSKGGRMVERAMEPDRNYIRLGGGTLAMPSRALMLVRTVGHLMTTDAVLDAAGQEVP
EGMLDAMITVLCALHDVHPDVGARRNSRAGSVYLVKPKLHGPEEVQLAVDLFARVEAALG
LPVNTVKIGIMDEERRTTVNLKECIRVARERIIFINTGFLDRTGDEIHSGMEAGPVPRKG
DMKRQPWLLAYEDWNVDVGLACGLPGHAQIGKGMWTMPDEMRAMLASKIAHPQAGANCAW
VPSPTAATLHAIHYHQVDVAEVQAELARGGRRASLDDLLQVPTVLDPAWTAEEIQQELDN
CCQGILGYVVRWIDQGVGCSKVPDIANVGLMEDRATLRISSQQVANWLHHGVVSRERVLE
TLQRMAGVVDGQNAGDPCYRPMAPGFDGIAFEAARELIFQGRAAPNGYTEPRLHAMRRRR
KQLDGTRADS
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaacgactggagaccggcggcctcaaggtcgccaaacccttgtatgacctggtc
agcaacgagatcgctccaggaaccgggattgccccggacgatttctggagagatttcggc
gcaatcctgagcgagcttgcgccgcgcaatcgcgagctgctcgcccggcgggacgcgcta
cagacgcagctcgacgcctggcatcgcgagcgccgcggccagcaattggatctggacgcc
tatcgcgcctatctgtccgagattggctatctggttcccgagggaccggatttcctggtc
agcaccaccaatgtcgacccggaaatcgccgcgattgccggcccccagctcgtggtgccg
ctgagcaatgcgcgctatgccctgaacgcggccaatgcgcgctggggcagtctctacgac
gcgctctatggaaccgatgcgattccggaggaggatcatctcaagcgcggtcacgacttc
aaccccgagcgcggggcggcggtggtcgcgcgcgccgcggcctttctggacgcgaccgtc
ccgctcaatcgcggctcctacggcgatgcgtgcggattcaagctcgaacagggcaagctg
gtcgtctgtctccccgataacagtcagaccatgctgacggatccggcgcaattcatcggc
taccgcggcagtccggaacaggtttcggccattctgctcgtccatcatggactgcatatc
gagatccagatcgaccgcgagcacgccatcggcagggagagcccgtccgggatcgcggac
atcctgctggagtccgccgtgacctgcattcaggactgcgaggactcggtcgccgccgtc
gataccgaggacaaagtcggcgtgtatcgccactggctcggcttgatgaaaggcgatctg
accgtgcagttcagcaagggcggccggatggtcgaacgcgcgatggaacctgatcgcaac
tatatccggctcggcggcggcaccttggccatgcccagccgcgcgctcatgctggtgcgc
acggtcggccatctgatgaccaccgacgccgtgctcgacgccgcgggccaggaggtgccg
gaaggtatgctcgacgccatgatcacggtcctgtgcgcgctgcacgacgtgcaccccgat
gtcggcgcgcggcgcaactcgcgcgccggcagcgtctacctcgtcaagcccaagctgcac
ggacccgaggaggtccagcttgccgtcgacctcttcgcgcgcgtcgaggcggccttgggt
cttcccgtcaacacggtcaagatcggtatcatggacgaggagcgtcgcaccacggtaaac
ctcaaagaatgcatccgggtcgcccgcgagcggatcatcttcatcaataccggttttctc
gaccgcaccggcgacgagattcatagcggcatggaagccggtccggtgccgcgcaagggc
gacatgaagcgccagccctggctcctggcctacgaggactggaatgtggatgtgggtctg
gcctgcggcctgcccggacacgctcagatcggcaagggcatgtggaccatgccggacgag
atgcgcgccatgctcgcgagcaagatcgcgcatcctcaggccggcgccaactgcgcctgg
gtgccctcgccaaccgccgcgaccctgcatgccatccactatcatcaggtcgacgtggcc
gaggttcaggccgaactggcacggggcgggcgccgcgccagtctggacgatcttctgcag
gttccgacagtgctcgatccggcctggaccgccgaggaaatccagcaggaactggacaac
tgctgtcagggtattctgggttatgtggtgcgctggatcgatcagggcgtgggctgttcc
aaggtgccggacatcgcgaacgtaggtctgatggaagaccgcgcgaccctgcgcatttcc
agtcagcaggtcgccaactggctgcatcatggggttgtcagtcgggaacgggtgctggaa
acgctgcaacgcatggcgggcgtggtggacggtcagaatgccggcgatccgtgctaccgg
cccatggcgcctggcttcgacggcatcgccttcgaggccgcccgcgagctgattttccag
ggccgagcggccccgaacggctataccgaaccccggctgcatgccatgcgccgacgacgc
aagcaattggatggcacgcgagcggattcctga

DBGET integrated database retrieval system