KEGG   Thiocystis violascens: Thivi_2408Help
Entry
Thivi_2408        CDS       T02138                                 

Definition
cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
tvi  Thiocystis violascens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thivi_2408
Enzymes [BR:tvi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Thivi_2408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2629953..2633684)
Genome map
AA seq 1243 aa AA seqDB search
MPKRTSVAEMRAKTSDATPVRVVIVNLDGHLSGTTQRALPSLQRELPGLRLNLHAATEWA
DSPEALERCLADIAEGDIVMTTMLVMEDHFKPILSAMAARRDHCDAMIVCMSASELMKMT
RMGGFAMDGTPGGPMALLKRLRGNKERKQSTGAQQMSMLRRIPKLLRFIPGTAQDVRAYF
LTLQYWLAGSDENLGNMVRFLVDRYADGPRRHLRGTLKVAAPVEYPEVGIYHPRMKGHIS
DKLSQLPVVNAKPKGRVGLLLMRSYVLAGNASHYNGVIESLEARGLQVVPAFASGLDARP
AIEKFFMKDGQATVDTVVSLTGFSLVGGPAYNDSKAAEEMLSRLDVPYLSTLAVEFQTLD
QWEDSNQGLLPVEATMMVAIPELDGATGSMVYGGRNGGGNNDARDMQSHGERAEALGARV
EHLVRLRRSQRAERKVAIVLFNFPPNAGNTGTAAYLSVFASLHRTLLAMDAAGYRVDLPE
DLDDLRERIVNGNAARFGAHANVHIRVPADDHVRREPWLAEIEKQWGPAPGKHQTDGGSL
FVLGAQFGNIFVGIQPSFGYEGDPMRLLFEKGFTPTHAFTTFYRYIREDFGAHAVLHFGT
HGALEFMPGKQAGLSGACWPDRLIGDLPNIYLYASNNPSEGTIAKRRAAATLISYMTPPI
AHAGLYKGLVDLKGSMERWRGLPPDDVDERTQLAELIQAQAAELELAKLEPAWCESAESE
VVTLNEKVLELEYTLIPHGLHVVGEAPTEDERLDMLEAVAESLKDIRPDRHSIRALMAGK
SPEKALKAGGMATSEENVALFRELAEIDRLLIQDSEIPAMLRALDGRFIRPAPGGDLLRT
PAILPTGRNLHGFDPFRLPSIYAVKDGFLQATRVIERHMAEGNPFPETIAIVLWGTDNLK
TEGGPIGQALALIGARPRFDNYGRLAGATLIPLEELGRPRIDVVMTLSGIFRDLLPLQTK
LLAEASFQAASADEPLEQNFIRKHALAYQEAQGCDLETAALRVFSNADGAYGANVNYLVD
SSSWDEGDELAETYTRRKSFAYGRSGQPVQQAALLKSVLSTVQLAYQNLDSVELGVTTVD
HYFDTLGGITRAVGQYKGDEVPVYIGDQTRGDGVVRTLAEQVALETRTRMLNPKWYEGML
KHGYEGVRQIEVHVTNTMGWSATTGQVAPWVYQQLTETFVLDEEMRNRLAQLNPTASAKV
ANRLIEAHERNYWSPDEATLEALRRAGEELEDRLEGVIEEAAA
NT seq 3732 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagcgcacttcggtcgctgagatgcgtgccaaaacttccgatgcgacgccggtg
cgtgtcgtcatcgtcaatctcgatgggcatctctcggggacgacgcaacgcgcgcttccg
tcgctgcagcgcgagttgccgggtctgcgcctgaatctgcacgccgccaccgaatgggcc
gattcgcccgaggcgctggaacgctgtctggccgatatcgccgagggcgacatcgtgatg
accaccatgctggtcatggaggatcacttcaaaccgatcctgtccgccatggccgcccgt
cgcgaccactgcgacgccatgatcgtttgcatgtcggccagcgagctgatgaagatgacc
cgcatgggcggcttcgcgatggatggcacgccgggcggccccatggccctgctcaaacgg
ctgcgcggcaacaaggaacgcaagcagagcaccggcgcccagcagatgtcgatgctccgg
cgcatccctaagctgctgcggtttatccctggtaccgcccaggacgtgcgcgcctatttc
ctgaccctgcaatactggctcgccggttccgacgagaacctcggtaacatggtccgtttc
ctggtggatcgctatgccgacggtccgcgccgtcatctgcgcggcaccctgaaggtcgcc
gccccggtcgaatatcccgaagtcgggatctatcacccgcgtatgaagggccacatctcc
gacaagctctcccagcttccggttgtcaacgccaagcccaaaggccgggtcggtctgctg
ctgatgcgctcctatgtgctcgccggcaacgccagtcattacaacggtgtgatcgagtcg
ctcgaagcgcgcgggctgcaagtcgtgccggccttcgccagcggtctggatgcgcgcccg
gcgatcgaaaaattcttcatgaaggacggacaggcgacggtggatacggtcgtctcgctg
accggtttttcgctggtgggcggtcccgcctataatgactccaaggccgccgaggaaatg
ctctcccggctcgacgtgccctatctttcgaccctggccgtggagttccagaccctcgac
caatgggaagactccaatcagggtctgctcccggtcgaggcgaccatgatggtcgcgatt
ccggaactcgacggcgcgaccggctccatggtctatggcggtcgcaatggcggcgggaac
aacgatgcgcgcgacatgcagtcgcatggcgaacgcgccgaggcgctgggcgcgcgtgtg
gagcatctggtgcggctacgtcgcagccagcgcgccgagcgcaaggtcgcgatcgtgctc
ttcaattttccgcccaatgccggcaacaccggcacggccgcttatctgtcggtcttcgcg
tcgctccatcgcactctgctcgccatggacgcggcgggttatcgcgtcgacctgcccgag
gatctggacgacctgcgcgagcgcatcgtcaacggtaacgcggcccgcttcggcgcccat
gccaatgtccatatccgcgtcccggccgacgaccatgtgcgccgcgagccctggctcgcc
gagatcgaaaagcagtggggtccggcgcccggcaagcatcagaccgacggcggctcgctg
ttcgtgcttggcgcccagttcggcaatatcttcgtcggcatccagccgtccttcggctac
gaaggcgaccccatgaggttgctgttcgaaaaggggtttaccccgacccacgccttcacc
accttctatcgctatatccgcgaggatttcggcgctcacgccgtgctgcacttcggcacc
catggtgcgctggagttcatgcccggcaaacaggccggtctgtccggcgcctgctggccg
gatcgtctgatcggggatctgccgaacatctatctctatgcctcgaacaatccgtccgag
ggcaccatcgccaagcggcgcgccgcggcgaccctgatcagctacatgacgccgccgatc
gcgcatgctggcctttataaggggctggtcgatctgaagggttccatggagcgctggcgc
gggctgccgccagacgatgttgacgagcgcactcaacttgccgaattgatccaggctcag
gccgccgagctggaactggccaaactggagcccgcctggtgcgagtccgctgaatccgag
gtcgtcacgctcaacgaaaaggtactggaactcgaatacaccctgattccgcacgggctc
catgtcgtcggcgaggcgccaaccgaggacgagcggctggatatgctggaggcggtggcc
gagtcactgaaggacatccgcccagatcgtcattcgatcagggcgttaatggccggcaag
tcgccagagaaggcgttgaaggccggcgggatggcgaccagcgaggaaaacgtggcgctg
ttccgcgaactcgccgaaatcgaccgcttgctcatacaggacagcgagatcccggcgatg
ctgcgggcgctcgacgggcgctttatccgtccggcccctggcggcgacctgctgcgtacc
ccggcgatcctgccgaccggtcgcaacctgcatggcttcgaccccttccgcctgcccagc
atctatgccgtgaaagatggtttcctgcaggccacccgcgtaatcgagcgccacatggcg
gagggcaatcccttccccgagaccatcgccatcgtgctctggggcaccgataacctcaag
accgagggtggccccatcggtcaggcgctggccctgatcggcgcgcgtccgcgtttcgat
aactatggccgactggcgggcgcgaccctgattccgttggaggagctgggtcgcccgcgc
atcgacgtggtcatgacactgtcgggcatcttccgcgatctgctccccttgcagaccaag
ttgctggccgaagcctccttccaggccgcgtcggccgacgagccgctggagcaaaacttc
atccgcaagcacgcgctcgcctatcaggaggcgcagggttgcgatctggaaacggccgcg
ttgcgcgtcttcagtaacgccgacggcgcctatggcgcgaacgtcaactatctggtcgac
agcagcagttgggacgaaggcgacgaactcgccgagacctacacccgccgcaagagcttt
gcctacggccgctcgggtcagccggtgcagcaggcggcgctcttgaagagcgtgctgagc
acggtgcagttggcctatcagaacctggattcggtcgagttgggcgtgaccaccgtcgac
cattatttcgacaccctcggcggcatcacccgcgcggtcggtcagtacaagggcgacgag
gtgccggtctatatcggcgatcagacgcgcggcgacggcgtggttcgcaccttggccgag
caagtggcgctggagacccgcacccgcatgctcaatccgaaatggtacgaaggcatgctc
aagcacggctacgaaggcgtgcgtcagatcgaggtccatgtcaccaacaccatgggctgg
tcggccacgaccggacaggtcgcgccctgggtctatcagcagctcaccgagaccttcgtg
ctcgacgaggagatgcgtaatcggctggcccaactcaacccgaccgcctcggcgaaggtc
gccaatcgactgatcgaggcccatgaacgcaactactggtcgccggacgaggcgacgctt
gaggcattacgccgggcgggagaagaattggaagatcggcttgagggtgtgatcgaggag
gcggcggcgtga

DBGET integrated database retrieval system