KEGG   Thiocystis violascens: Thivi_2576Help
Entry
Thivi_2576        CDS       T02138                                 

Definition
(GenBank) methylase of chemotaxis methyl-accepting protein
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
tvi  Thiocystis violascens
Pathway
tvi02020  Two-component system
tvi02030  Bacterial chemotaxis
Module
tvi_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Thivi_2576
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Thivi_2576
Enzymes [BR:tvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Thivi_2576
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Thivi_2576
Two-component system [BR:tvi02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Thivi_2576
Bacterial motility proteins [BR:tvi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Thivi_2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_10 CheR_N PAS_4 PAS_9 PAS_8 PAS DUF812 IncA DUF745 Fez1 Rootletin CENP-F_leu_zip Spc7 Methyltransf_12 Leu_zip Exonuc_VII_L Golgin_A5 HMMR_N AAA_13 APG6 IFT57 TPR_MLP1_2 FAP206 Methyltransf_25 Laminin_II OmpH FapA HAUS-augmin3 HemX DUF4407 LXG Fusion_gly GAS CorA zf-C4H2 AAA_23 DUF1664 Reo_sigmaC DUF3584 DUF4795 LMBR1 HOOK
Motif
Other DBs
NCBI-ProteinID: AFL74510
UniProt: I3YBZ2
Position
complement(2829557..2832694)
Genome map
AA seq 1045 aa AA seqDB search
MDRKKTNNANPDSTSAPTQAADAPDAPLDASSAGVPNTDAAPEPDSEPAPEPPFPIVGIG
ASAGGLAAFEAFFSAIPTDLQTGMAFVLVQHLAPDHKSILTELVKRYTSMEVQEVVDGVA
VRPDCAYIIPPNLDMALLNGKLHLLEPKAPRGLRLPIDFFFRSLAQDQGERAICVILSGT
GSDGTLGARAIKGEGGMVMAQTPKSAAYDGMPRSVLATGLVDFELAPAEMPAKLMDFAAH
AFGRKPRAPVSPRPRVVDALNKICILLRDRTSHDFSQYKQSTLERRIERRMALHRIDKQD
DYLRYLQKDPTEVDALFQDLLVGVSCFFRDPEAFAVLERDVIPGLFANRPAGAPVRVWVC
GCSTGEEAYSVAILLQEHLETLKKTYRVQIFATDLDARSIERARVGVYPASIAVDVSTER
LARFFSQDAEDGVYRIQKVVRDLLVFSEQNLIKDPPFSRLDLISCRNLLIYLNSDLQKRL
ISLFHYALNPGGVLFLGSSETVGEALTSFAPLSRKWKLYVRQESSLSVPALAPSHFPPPL
PGNARLPTPAPSGRSQAGSESRVLTERALLNHFNPVGILTNGRGEILYIHGRSGQYLEPA
AGDAAMNILDMAREGLRRELTLSLQRAVARKESVHLPALRVKTNGDFTGVNLTVHPAQAL
DGDVLPDLYLVVLEPVPTPAVETRAAEDAGGGKPGGGARRIAELESELRAKEEYLQSTLE
EMQTANEELKSTNEEMQSVNEELQSTNEELETSKEELQSVNEELATVNVELQDKVADLSR
ANNDMNNLLAGTGIATLFVDHQLRITRFTPATTQLIKLIQSDIGRPVGDIVSNFVDYDDL
VRDARAVLKSLTPLEAEVRIRRGDWYLMRIGPYVTLDKIIEGAVITFMDISSRKRMEQGL
EEARALAAGIVETVREPLIVLDGELRVVSANRAFHRDFQLSPAQSLGQTFWELGNGQWDL
PALRTLLLELQSHGRGFEDYRVSATFAGLGQRTLLLNARRLDPVAGHAGAILLAIEDITE
RMRQSETVSVSEPAAPRPPGACDDS
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atggacaggaaaaaaaccaataacgcgaacccggattccacgtcggcacccacccaggcg
gccgatgcgccagacgcgccgctcgacgcgtcgtcagcgggcgttccgaacaccgatgcc
gcgccagagccggactcggaaccggcgcccgagccgccgttccccatcgtcggcatcggc
gcctcggcgggcggtctggcggccttcgaggcgtttttctccgccatccccaccgatctt
caaaccggcatggccttcgtgctggtgcagcatctcgcgcccgatcacaagagcatcctg
accgagctggtcaaacgctacacgagcatggaggtccaggaggtcgtcgacggcgtggcg
gttcggccggactgcgcctatatcatcccgcccaaccttgatatggcacttttgaacgga
aagctccacctgctggagcccaaggcgccgcgcgggctgcgtctgcccatcgacttcttc
ttccgctcgctggcccaggatcagggcgagcgggcgatctgcgtcatcctctccggcacc
gggagcgacgggacgctgggcgcgcgggcgatcaagggcgagggcggcatggtgatggcg
cagacacctaagagcgcggcctacgatggcatgccgcgcagcgttctggccaccgggctg
gtggatttcgagctggcgccggccgagatgccggcgaaactcatggacttcgcggcgcat
gcttttggcagaaaaccgcgcgcgccggtctcgccgcgcccgcgggtcgtggatgcgttg
aacaagatctgcatcctcctgcgcgaccgtaccagccacgatttttcgcagtacaagcag
agcacgctggaacggcggatcgagcggcgcatggcgctgcaccggatcgacaaacaggac
gattatctgcgctatctccagaaggatccgacggaggtcgacgcgctgtttcaggatctg
ctggtcggcgtcagttgcttctttcgcgatcccgaggccttcgccgtgctggaacgcgac
gtcatcccagggctgttcgccaatcggccggcgggcgcgccggtgcgcgtctgggtgtgc
ggctgttccaccggcgaggaggcttattccgtcgccatcctgctccaggaacacctggaa
accctgaaaaaaacctatcgggtgcagatcttcgccaccgatctcgacgcccgctcgatc
gagcgcgcgcgcgttggcgtctatcccgcgagcatcgccgtcgatgtctccaccgagcgg
ctcgcgcgtttcttctcccaggatgccgaggatggcgtctatcgtatccagaaggtcgtg
cgcgatctcctggtgttctccgaacagaacctgatcaaggatccgcccttttcgcgcctg
gatctgatcagttgccgcaatctcctgatctatctgaacagtgacctgcagaaacggctg
atttcgctcttccactatgccctgaatcccggtggcgtgctgtttctgggcagttcggag
acagtgggcgaggcgctcacgtcgttcgcgccgctcagccggaagtggaaactctatgtc
cgtcaggagtcgtcgctgagcgttcccgcgctggcgccgagccatttcccgccgcccctg
cccggcaacgcgcggctgcccacgcccgcgccgtcgggacggagccaggccgggagcgag
tcgcgcgtgctgaccgaacgggccttgctgaatcatttcaatccggtcggaattctgacc
aacgggcgcggcgagattctctatatccatggccgcagcgggcagtatctggaacccgcc
gccggggatgccgccatgaacatcctcgacatggcgcgcgaggggttgcgccgcgagctg
acgctgtcgctgcagcgggcggtggcgcgcaaggagtcggtccatctgccggcgttgcgg
gtcaagaccaacggcgacttcaccggcgtcaatctgaccgtgcatccggcccaggcgctc
gatggcgacgtcctgccggacctctacctggtggtgctggagccagtgcccacgccggcg
gtcgagacgcgcgccgcggaagacgccggcggcgggaaacctggcggcggcgcgcggcgc
atcgcggagctggaatcggaactgcgggccaaggaggaatatcttcagagcaccctggaa
gagatgcagaccgccaacgaggagctgaaatcaaccaacgaggagatgcaatcggtcaac
gaggaactgcaatccactaacgaagagctggagacctccaaggaagagctgcaatcggtc
aacgaggaactggccaccgtcaacgtcgagttgcaggacaaggtcgccgacctgtcgcgc
gccaataacgacatgaacaacctgctggccggaaccgggatcgccaccctgttcgtcgat
caccaattgcgcatcacccgcttcacccccgccacgacgcagttgatcaagctgatccag
agcgacattggacggccggtgggcgacatcgtctccaacttcgtggactacgacgatctg
gtcagggacgcgcgcgccgtcctgaagagcctgaccccactggaagcggaggtccggatc
cggcggggcgattggtatctgatgcgtatcggaccctatgtcacgctcgacaagatcatc
gagggggcggtgattaccttcatggacatttcctcgcgcaagcggatggagcagggactc
gaagaggcgcgcgcccttgccgcgggcatcgtggagacggtgcgcgagccgctgatcgtg
ctggacggggagttgcgcgtggtctcggccaaccgggccttccatcgcgactttcagctc
tccccggcccagtccctggggcaaaccttctgggagctgggcaacgggcaatgggatctc
ccggccttgcggaccctgctgctggagctccagtcgcacggcaggggtttcgaggattac
cgggtcagcgccacgtttgcgggactcggccagcgcaccctgctattgaatgcgcgccgt
ctcgacccggtcgccggtcatgccggcgccattctgctcgcgatcgaggatatcaccgaa
cggatgcgccagagcgagacggtctccgtctcggaaccggcggcgcctcgtccgccaggg
gcttgcgatgactcataa

DBGET integrated database retrieval system