KEGG   Thiocystis violascens: Thivi_2611Help
Entry
Thivi_2611        CDS       T02138                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tvi  Thiocystis violascens
Pathway
tvi00300  Lysine biosynthesis
tvi01100  Metabolic pathways
tvi01120  Microbial metabolism in diverse environments
tvi01230  Biosynthesis of amino acids
Module
tvi_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Thivi_2611
Enzymes [BR:tvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Thivi_2611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFL74545
UniProt: I3YC27
Position
2865083..2866219
Genome map
AA seq 378 aa AA seqDB search
MSPTLALARDLIARPSVTPDDRGCQDLMAERLAALGFRIEPMPFGEVTNLWARRGDTGPV
FCFAGHTDVVPTGPLDRWNSDPFVPTIRDGRLYGRGAADMKGSLAAMVTAVESFVAEYPD
HTGSIAFLITSDEEGPSIDGTVKVVERLEQRGEKIDYALVGEPSSRERLGDTIKNGRRGS
LNGFLKVRGKQGHVAYPQLALNPFHVSAPALTALCAEVWDQGNEHFPPTSFQIANLNMGT
GAENVIPGQLEVQFNLRFSTELTPEIIQTRVRRMLDAGGFDYDLTWRLSGSPFLTPAGEL
VAASRAAIRTVTGLDTQLSTSGGTSDGRFIAPTGAQVVELGPLNATIHQIDECVGVEELD
QLSDIYRLILERLLTERA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccacgcttgcgctggcccgcgatctgatcgcgcgcccttccgtcacgcccgat
gaccggggttgtcaggatctgatggccgagcgcctggccgcgctcggttttcgcatcgag
cccatgcccttcggcgaggtcaccaacctctgggcgcggcgcggcgacaccgggccagtc
ttctgtttcgccggacataccgacgtggtgccgaccggcccgctcgaccgctggaactcg
gaccctttcgttccgaccatccgtgacggtcggctttacggtcgcggggccgcggacatg
aaaggctcgctggcggccatggtcacggcggtggaatccttcgtggccgaatatcccgac
cacaccggctccatcgcctttctgatcacgagcgacgaggaaggcccttcgatcgacggc
accgtcaaggtcgtggagcgtctggaacagcgcggggaaaagatcgactatgcgctggtt
ggcgagccatccagccgcgagcggctaggcgataccatcaagaacggtcggcgtggcagc
ctgaacggttttctgaaagtccggggcaaacagggccatgtcgcctatccgcaactcgca
ttgaaccccttccatgtcagcgccccggcgctgaccgcgctttgcgccgaagtctgggac
cagggcaacgagcacttcccgccgaccagtttccagatcgccaacctgaacatgggcacg
ggcgcggagaacgtgattccgggccagttggaggtgcagttcaatctgcgtttctcgacc
gaattgacgcccgagatcatccagacgcgggtccggcggatgctcgatgccggcggtttc
gactatgacctgacctggcggctctccggcagtccttttctgacgccagcgggcgaactg
gtggcggcatcgcgcgcggccatccggacggtcacggggctggatacccagctctcgacc
agcggcggcacctccgatggccgtttcatcgcacccaccggcgctcaggtcgtggagtta
ggtccgttgaacgccaccatccatcagatcgacgagtgcgtcggggtggaagaactcgac
caactctccgacatctatcgactgatcctggagcggcttttgaccgagcgcgcctag

DBGET integrated database retrieval system