KEGG   Thiocystis violascens: Thivi_2711Help
Entry
Thivi_2711        CDS       T02138                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tvi  Thiocystis violascens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tvi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2974665..2975261)
Genome map
AA seq 198 aa AA seqDB search
MAERSLLNQLIDALRCLPGVGPKSAQRMAFHLLERDREGGARLARVMADAMARVQSCRRC
RTLSEHDLCGICANPKRDASLLCVVEQPSEIVAIDQATDFRGLYFVLGGRLSPLDGIGPD
ELGLDVLEGRLRDESIMEVILAISPTVEGSATAQFIADFAARHGVKITRIAHGVPLGGEL
EHVDGGTLALAFAGRRDL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgctccttgctgaatcagttgatcgatgccctgcgctgtctgccgggcgtt
gggccgaaatcggcgcagcggatggccttccatctgctggagcgcgatcgggagggcggt
gcccgtctggcgcgcgtcatggcggacgccatggcccgggtccagagctgtcggcgctgc
cgaaccctgagcgaacatgatctgtgcgggatctgcgccaatcccaaacgcgatgcgagc
ctgctctgcgtggtcgagcagccctccgagatcgtcgccatcgatcaggcgaccgatttt
cgcggtctctatttcgtgctcggggggcggctctcgccgctcgatggaatcggccccgat
gaactggggctcgatgtactggaaggccgtttacgagacgaatcgatcatggaggtgatc
ctggccatcagtccgaccgtggagggcagtgcgacggcgcagttcattgccgatttcgcc
gcccgccatggggtgaagatcacccgtatcgcccatggggtaccgctgggcggcgaactg
gagcatgtcgacggggggacgctggcgctggcctttgccggacgccgtgacctttaa

DBGET integrated database retrieval system