KEGG   Thiocystis violascens: Thivi_2901Help
Entry
Thivi_2901        CDS       T02138                                 

Definition
(GenBank) alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tvi  Thiocystis violascens
Pathway
tvi00500  Starch and sucrose metabolism
tvi01100  Metabolic pathways
tvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thivi_2901
Enzymes [BR:tvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Thivi_2901
Exosome [BR:tvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thivi_2901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AFL74807
UniProt: I3YCT9
Position
3188722..3190998
Genome map
AA seq 758 aa AA seqDB search
MASAKGSASKLPEPLLRIVEARHYDPFEVLGRHVNEQQAVVRAFLPMAESAILVEAGEAF
NRIEGSDFFIWEGAAAKVPERYRIAWQDAAGTTHSAYDPYCFPLQLEDFDIHLFGEGRHW
HAYRFLGSHLREVEGISGVQFAVWAPNAERVSVVGDFNQWDGRVHSMRVRGGSGVWELFI
PGLETGGFYKYEIRDRHTNIHIKIDPYAQAFQERPQTAGLICPESRFKWSDADWLKARAE
SDWQHQAFSVYEVHLGSWMRDADGNFVNYRILAKQLGDYVAELGFTHIELLPITEHPLDA
SWGYQCTGYFAPSARFGTPDDFRFFVDYLHRKGIGVLLDWVPAHFPKDAYALARFDGTAL
YEHADPRMGEHKDWGTLIFNFGRNEVKNFLLSSALYWLDEFHLDGLRVDAVASMLYLDYS
RNAGEWIPNKYGGNENLEAVDFVRQLNTVTHEQHPGTLMIAEESTAWPAVSRPTYLGGLG
FSMKWNMGWMHDTLSYMQKDPIYRHFHHDLLTFGLLYAFTENFVLPFSHDEVVHGKKSML
DKMPGDGWQKFASLRLLYTFMFSYPGKKLLFQGCEFGQGTEWDFSASLDWELLERPQHLG
LKTLVSDLNHLHRELPALHEVDFDASGFEWIDCHDSSQSVLSYIRKSKSGQDLVAAAFNF
TPVPRNNYRIGVPEPGFYREAMNSDAEVYGGSNVGNQGGVEAEPLSWMGRPYSIPIALPP
LGGLIMVHEPVRVDSVEEDSLAESTAAELPADQTDEAD
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgcaaaaggctccgcatcaaagctcccggaacccctgctgcgtatcgtcgag
gcgcgccattatgaccctttcgaggtgttgggccgtcacgtcaacgaacagcaggcggtg
gtccgcgcgtttctgcccatggccgaaagcgcgattctggtggaagctggcgaggcgttc
aaccggatcgaaggctccgatttctttatctgggaaggcgctgccgctaaggttcccgag
cgttatcgcatcgcgtggcaggatgcggccggtaccacgcatagcgcctatgacccctac
tgttttccgctccagcttgaagatttcgacatccatctgtttggcgaggggcgtcattgg
catgcctatcgttttctaggttcgcatctgcgcgaggtcgaaggaatctccggggttcag
ttcgcggtgtgggcgccgaatgcggagcgggtgagcgtcgttggcgattttaaccaatgg
gacggtcgcgttcattccatgcgcgtgcgcggcggcagcggtgtttgggaactgttcatc
cctggcctggagactggcggtttctataaatacgagatccgcgaccgtcacaccaatatt
cacatcaagatcgatccctatgcccaggccttccaggaacggccgcagaccgccggactc
atctgccccgaaagtcgcttcaagtggtccgatgcggactggctgaaggcgcgcgcggaa
tcggattggcagcatcaggccttttcggtctacgaagtgcatcttggatcctggatgcgg
gatgccgatggcaatttcgtcaactatcgaatcctggccaaacaactcggcgactatgtg
gctgaactgggcttcacgcatatcgagttgctgccgatcaccgagcacccgctcgatgcc
tcctggggctatcaatgcactggctatttcgcgcccagcgcacgcttcggtacgccggac
gatttccgctttttcgtcgattatctgcatcgtaaggggattggcgtgctgctcgattgg
gtgccggcccatttccccaaggatgcctacgcactggcgcgtttcgatggcacggcgctc
tacgagcacgccgatccgcgcatgggcgagcacaaggactggggcaccctgatcttcaac
ttcggccgcaacgaggtgaagaacttcctgctttccagcgcgctttactggctggacgag
ttccatctcgatgggctgcgcgtcgatgccgtcgcctccatgctttatctcgattattca
cgcaacgccggcgaatggattcccaacaagtacggcggcaacgagaatctcgaagccgtg
gactttgtccgccagctcaataccgtgacccacgaacagcaccccggcaccctgatgatc
gccgaggaatccactgcctggccggcggtctcgcgcccgacctatttgggcggtctcggg
ttcagcatgaaatggaacatgggctggatgcacgacaccctctcctatatgcagaaggat
cccatctaccgtcatttccaccatgacctgctgaccttcggcctgctctacgccttcacc
gagaacttcgtgctgcccttctcgcacgatgaagtggtgcacggcaaaaaatccatgctg
gacaagatgcccggcgacggctggcagaaattcgccagtctgcgtctgctctacaccttc
atgttcagttatcccgggaagaaactcctttttcagggctgcgaattcggacagggaacc
gaatgggatttttccgcgtcgctggactgggaattgcttgaacgaccccagcatctgggg
ctgaaaacgctggtctccgatctgaaccatctgcaccgcgaactgcccgcgctgcacgaa
gtcgatttcgacgcctcggggttcgaatggatcgactgtcacgatagctcgcagtcggtg
ctgagttatatccgcaagagcaaatccggtcaggatctcgtcgccgccgcgttcaatttc
acgccggtgccgcgcaacaattaccgaatcggcgttcctgagcccggtttttatcgagag
gccatgaattcggacgcagaggtctatggcggcagcaatgtcggtaatcagggcggcgtg
gaagcggagcccttgagctggatggggcgtccctactcgatcccgatcgcgctcccgccc
cttggcggattgatcatggtccatgagcccgtgcgcgtcgactccgtcgaagaggacagc
cttgccgaatcgaccgctgccgagcttcccgcggatcagaccgatgaggccgattga

DBGET integrated database retrieval system