KEGG   Thiocystis violascens: Thivi_2972Help
Entry
Thivi_2972        CDS       T02138                                 

Definition
(GenBank) diguanylate cyclase (GGDEF) domain-containing protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
tvi  Thiocystis violascens
Brite
Enzymes [BR:tvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Thivi_2972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3257814..3258854)
Genome map
AA seq 346 aa AA seqDB search
MTVKRMAFPEDLRTSSDYLRMAVPLMIERKIPPTPYNYALWYAHVQQISPELSKALLEEF
PRAGSYDQDKSESLFFEFFVKNYLPNNRKAQNFVVSILTQLAQAVSRNVKGTEAYGSALK
DAMEIFDAAVDQQRIRDMLTQLLTDTATVETLNMEFQLELQSARVEVEKLRRELEESQYS
ARFDTLTKIANRRAFNDAFAQALGMPDDPTCLLLLDLDKFKVCNDTYGHLTGDRILEIVG
GILGGFQSETIFVARYGGEEFAVIVKDSLAAAQDIAETIRQKVSAIHLTKKDTHDLIGVI
TVSIGVVLARVGETPEEIIGRADAALYRAKDQGRNRVVTDGVGDAV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaaaaggatggcctttcccgaagatctcagaacgtcgtccgattatcttcgg
atggccgtgcccttgatgatcgagcgaaaaattcctccgaccccttacaattacgccctc
tggtacgcgcacgtccagcagatcagtcctgaactcagcaaggcattgcttgaggaattt
ccccgcgccggttcctatgaccaggataaaagcgaatcgctcttttttgaatttttcgtc
aaaaattatttgccgaataatcggaaagcacaaaattttgtggtcagtatcctgacgcaa
ttagcgcaggcggtgtctaggaatgtcaagggcacggaggcctacggcagtgcattgaaa
gacgccatggagatcttcgatgccgcggtcgatcagcaaaggattcgtgacatgctcacg
cagctactgaccgataccgccaccgtcgagacgctgaacatggagtttcaactcgaactt
cagtcggcccgcgtcgaagtggaaaaactccgccgggaactggaggaaagtcagtatagc
gcgcgcttcgatacgctgaccaagatcgccaatcggcgcgccttcaacgacgccttcgcg
caggcgctcggaatgccggatgacccgacctgcctgctcctgctggatctggataaattc
aaagtctgtaacgatacctatggtcacctgacgggtgaccggattttggaaatcgtgggc
gggatcctgggcggattccagagcgaaacgatcttcgtcgcacgctatggcggcgaggaa
ttcgccgtcatcgtgaaagactcgctggcggcggcccaagacatcgccgagaccattcgt
caaaaagtgtcggcgatccatctcaccaagaaggacacgcacgacttgatcggcgtgatt
accgtatccattggcgtggtcctcgcgcgcgtcggcgaaacgccggaggaaatcattggg
agagccgacgcggcactctaccgcgccaaggatcaggggcgaaatcgcgtggtcaccgat
ggcgtcggagatgcagtttaa

DBGET integrated database retrieval system