KEGG   Thiocystis violascens: Thivi_2972Help
Entry
Thivi_2972        CDS       T02138                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
tvi  Thiocystis violascens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3257814..3258854)
Genome map
AA seq 346 aa AA seqDB search
MTVKRMAFPEDLRTSSDYLRMAVPLMIERKIPPTPYNYALWYAHVQQISPELSKALLEEF
PRAGSYDQDKSESLFFEFFVKNYLPNNRKAQNFVVSILTQLAQAVSRNVKGTEAYGSALK
DAMEIFDAAVDQQRIRDMLTQLLTDTATVETLNMEFQLELQSARVEVEKLRRELEESQYS
ARFDTLTKIANRRAFNDAFAQALGMPDDPTCLLLLDLDKFKVCNDTYGHLTGDRILEIVG
GILGGFQSETIFVARYGGEEFAVIVKDSLAAAQDIAETIRQKVSAIHLTKKDTHDLIGVI
TVSIGVVLARVGETPEEIIGRADAALYRAKDQGRNRVVTDGVGDAV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaaaaggatggcctttcccgaagatctcagaacgtcgtccgattatcttcgg
atggccgtgcccttgatgatcgagcgaaaaattcctccgaccccttacaattacgccctc
tggtacgcgcacgtccagcagatcagtcctgaactcagcaaggcattgcttgaggaattt
ccccgcgccggttcctatgaccaggataaaagcgaatcgctcttttttgaatttttcgtc
aaaaattatttgccgaataatcggaaagcacaaaattttgtggtcagtatcctgacgcaa
ttagcgcaggcggtgtctaggaatgtcaagggcacggaggcctacggcagtgcattgaaa
gacgccatggagatcttcgatgccgcggtcgatcagcaaaggattcgtgacatgctcacg
cagctactgaccgataccgccaccgtcgagacgctgaacatggagtttcaactcgaactt
cagtcggcccgcgtcgaagtggaaaaactccgccgggaactggaggaaagtcagtatagc
gcgcgcttcgatacgctgaccaagatcgccaatcggcgcgccttcaacgacgccttcgcg
caggcgctcggaatgccggatgacccgacctgcctgctcctgctggatctggataaattc
aaagtctgtaacgatacctatggtcacctgacgggtgaccggattttggaaatcgtgggc
gggatcctgggcggattccagagcgaaacgatcttcgtcgcacgctatggcggcgaggaa
ttcgccgtcatcgtgaaagactcgctggcggcggcccaagacatcgccgagaccattcgt
caaaaagtgtcggcgatccatctcaccaagaaggacacgcacgacttgatcggcgtgatt
accgtatccattggcgtggtcctcgcgcgcgtcggcgaaacgccggaggaaatcattggg
agagccgacgcggcactctaccgcgccaaggatcaggggcgaaatcgcgtggtcaccgat
ggcgtcggagatgcagtttaa

DBGET integrated database retrieval system