KEGG   Thiocystis violascens: Thivi_3381Help
Entry
Thivi_3381        CDS       T02138                                 

Definition
6-phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tvi  Thiocystis violascens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thivi_3381
   01230 Biosynthesis of amino acids
    Thivi_3381
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thivi_3381
   00030 Pentose phosphate pathway
    Thivi_3381
   00051 Fructose and mannose metabolism
    Thivi_3381
   00052 Galactose metabolism
    Thivi_3381
  Energy metabolism
   00680 Methane metabolism
    Thivi_3381
Enzymes [BR:tvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thivi_3381
Protein phosphatases and associated proteins [BR:tvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Thivi_3381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3694935..3696188)
Genome map
AA seq 417 aa AA seqDB search
MSAKNAFYAQSGGVTAVINASACGVIETARRHTDQIANVYAGRNGIIGALTEDLIDTSQE
SDEAIAALRYTPSGAFGSCRYKLKSLEANRREYERLIEVFKAHDIGYFFYNGGGDSADTC
YKVSQLSEALGYPVQAIHVPKTVDNDLPITDNCPGFGSVAKYIATSALEASFDVRSMCKT
STKVFVLEVMGRHAGWIAAAGGLIEDHNIPVMILFPEIEFDQARFIAAVKEKVERFDFCT
IVVSEGAKYPDGRFLAEQGTRDAFGHAQLGGAAPVVANMIKDATGYKFHWAVADYLQRAA
RHLASKTDVEQAYAMGRAGVEFALAGHNAVMPTVRRLSSDPYAWEVGEAPLSEVANVEKF
MPRDFITEDGFGITPVCKEYLIPLIQGEDYPPFEHGLPKYVTLKNAPVARKLGTFEV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgaaaaatgccttttatgcgcaatccggcggcgtcaccgccgtcatcaacgcc
tccgcctgcggggtgatcgagaccgcccgccgtcacaccgaccagatcgctaacgtctat
gccggtcgcaacggcatcatcggcgcgctgaccgaggatctgatcgacaccagccaggaa
tccgacgaggccatcgccgcgctgcgctacaccccttccggcgccttcggttcctgtcgc
tacaagctcaaaagtctggaggccaaccggcgcgaatacgagcgtctgatcgaggtcttc
aaggcccacgacatcggctatttcttctacaacggcggtggcgactcggccgacacctgc
tacaaggtttcgcaactctccgaggcgctgggctatccggtccaggcgattcatgtcccc
aagacggtcgacaacgacctgccgatcaccgataactgccccggtttcggctcggtcgcc
aagtacattgccacctccgcgctggaagcctcgtttgacgtgcgctcgatgtgcaagacc
tcgaccaaggtgtttgtccttgaggtcatgggccgtcacgccggctggatcgccgccgct
ggcggtctgatcgaggaccacaacatcccggtcatgattctcttccccgagatcgaattc
gatcaggcgcggttcattgccgccgtcaaggaaaaggtcgagcgtttcgacttctgcacc
atcgtcgtctccgagggcgccaaatatcccgatggccgcttcctggccgaacagggcacg
cgcgacgccttcggtcacgcccagctcggcggtgccgcgcccgtggttgcgaacatgatc
aaggacgcgaccggctacaagttccattgggcggtggccgattatctccagcgcgccgcg
cgccatctcgcctccaagaccgatgtcgagcaggcgtatgccatgggtcgggccggggtc
gaattcgcgttggccggacacaatgccgtgatgccgaccgtccggcgtctgagcagcgat
ccctatgcctgggaagtcggcgaggcgccgctgtcggaggtcgccaatgtcgaaaaattc
atgccgcgcgacttcatcaccgaggacggtttcggcatcaccccggtctgcaaggagtat
ctgatcccgctgatccagggcgaggactatccgccattcgagcatggcctgccgaagtac
gtgacgctgaagaatgccccggtggcgcgcaagctcgggacgttcgaggtctga

DBGET integrated database retrieval system