KEGG   Thiocystis violascens: Thivi_3406Help
Entry
Thivi_3406        CDS       T02138                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tvi  Thiocystis violascens
Pathway
tvi00010  Glycolysis / Gluconeogenesis
tvi00020  Citrate cycle (TCA cycle)
tvi00620  Pyruvate metabolism
tvi01100  Metabolic pathways
tvi01110  Biosynthesis of secondary metabolites
tvi01120  Microbial metabolism in diverse environments
tvi01130  Biosynthesis of antibiotics
tvi01200  Carbon metabolism
Module
tvi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thivi_3406
   00020 Citrate cycle (TCA cycle)
    Thivi_3406
   00620 Pyruvate metabolism
    Thivi_3406
Enzymes [BR:tvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Thivi_3406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AFL75276
UniProt: I3YE58
Position
complement(3720180..3721910)
Genome map
AA seq 576 aa AA seqDB search
MATVEEILLPDIGDFSNVEVIEILVAPGDRIEVEQSVLTLESEKATIEIPSPKSGVVKEI
IAKVGGKISQGSPLMTLEVSETAEASDVSTPTAEPAVATPEVQPYRPSAATLATRPAPKA
PGKSVDSGETVSVVLPDVGDFSDVPVVEILIAPGDRIEVNQSLLTLETDKATMEIPSPQA
GVVEEVVVKLGDTLNPGDLILTLRAEPGAETSPPAAREAERPPPRPTPSQTATSIPDTAA
ERSTVSVRAHGEAERRQAPVLPRPEDMTAIAKGRKPHASPGVRRFARQLGVDLARVKGSG
PKGRVVKDDVQNFVKQALTQGAGAASATALPFQLPSAPEIDFARFGEVELTELPRIKKIS
GRHLHRSWITVPHVTQFDEADITELEAFRKNQQEAAAKEGVKLTFLPFLLKVVATALNRM
PILKASLSGDGEHLIHKRFTHIGVAVDTPKGLLVPVVRDVDRKSLYALARELTDLSAKAR
DGKLLPGDMQGGCFSISSLGGIGGTAFTPIVNAPEVAILGVSRSAIKPVWDGEAFAPRLL
LPLSLSYDHRVVDGADGARFTALLGQLLGDIRRLLL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaccgtcgaagaaattctgctgcccgacatcggggacttttccaatgtcgaggtg
atcgagatcctggtcgcccccggtgaccggatcgaagtcgagcaatccgtgctcacccta
gaaagcgaaaaagcgaccatcgagattccctcgcctaagagcggcgtggtgaaggagatt
atcgccaaggtcggaggcaaaatcagccagggttcgccgctgatgacacttgaggtgtcg
gagacggcggaggcaagcgatgtctcgactccgacggcggagccagccgtcgcgacaccg
gaagttcagccgtatcggccatcggccgccacgctcgcgacccggcccgcacccaaagcg
ccgggaaaatccgtcgatagcggcgagacggtttcggtcgtcctgccggacgtgggcgat
ttcagcgatgtcccggtggtcgagatcctgatcgcccccggcgaccggatcgaggtcaat
caatccctgctgacgctggagaccgacaaggcgaccatggagattccctcgcctcaggcg
ggcgtggtcgaggaagtagtcgtgaagctcggcgataccctgaaccccggcgatctgatc
ctgaccctgcgcgccgaacccggcgccgagaccagtccgccagcagccagggaagcggag
cgtccgccgccccgaccgacgccgagtcagaccgccacatcgatccccgacaccgccgcc
gaacgctcgaccgtcagcgtgcgggcacacggcgaggccgagcgccgacaggcgccggtg
ctgccgcgtccggaggatatgaccgccatcgccaaaggccgtaagccacacgccagcccc
ggcgtgcgccgcttcgcgcgccagctcggcgtcgacctggcgcgggtcaaggggtcaggc
cccaagggtcgcgtggtcaaggacgacgtgcagaacttcgtcaaacaggcgctcacccag
ggcgcgggcgccgcctccgcgacggcgctgcccttccagctcccctcggcccccgagatc
gattttgcccgtttcggcgaggtcgagctgaccgaactgccgcgcatcaagaagattagc
ggacggcatttgcatcgcagttggatcaccgtcccgcatgtcacccaattcgacgaggcg
gacattaccgaactggaagccttccgcaagaaccagcaggaggcggccgccaaggaaggc
gtcaagctcaccttcctgcccttcctgctcaaggtcgtcgccaccgcgctcaaccggatg
ccgatcctcaaggcatccctgagcggcgatggcgaacacctgatccacaaacgcttcacg
catatcggcgtggcggtcgacacccccaagggactgctggtgcccgtggtgcgcgacgtg
gaccggaaaagtctctacgcgctggcccgcgaactgaccgacctcagcgccaaggcacgc
gacggcaagctgttgcccggcgacatgcagggcggctgcttctccatctccagtctcggc
ggcatcggcggcaccgccttcacgcccatcgtcaacgcccctgaggtcgccattctcggc
gtctcccgctccgcgatcaagccggtctgggacggtgaagcgttcgcgccgcgactgctg
ctgccgctctcgctttcctacgatcaccgtgtcgtcgacggggccgatggggcacgcttc
acggccttgctggggcagttgctgggggatattcgtcggttattgctgtaa

DBGET integrated database retrieval system