KEGG   Thiocystis violascens: Thivi_3592Help
Entry
Thivi_3592        CDS       T02138                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tvi  Thiocystis violascens
Pathway
tvi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tvi01100  Metabolic pathways
tvi01110  Biosynthesis of secondary metabolites
tvi01130  Biosynthesis of antibiotics
tvi01230  Biosynthesis of amino acids
Module
tvi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thivi_3592
Enzymes [BR:tvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Thivi_3592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C DUF3730
Motif
Other DBs
NCBI-ProteinID: AFL75452
UniProt: I3YEN4
Position
3925472..3926278
Genome map
AA seq 268 aa AA seqDB search
MADTPDILKKIVHRKAEEVRARSERLPLSELIALAGDEPARGFADALHAKIAAGQPAVIA
EIKKASPSKGLLRADFRPAEIAVSYAHGGAACLSVLTDIDFFQGSDAYLKEARAACALPA
IRKDFIIDPYQVHEARAMGADCILLIAACLDDASLRDLNALAQALGMDVLVEVHDALELE
RALAVPGRLIGVNNRNLRTFEVSLETTIDLLGPIPADRLLVTESGILSRDDVARMRAQGV
NAFLVGEAFMRAEDPGAELARLFFTPAG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacacccgacatcctgaaaaagatcgtccatcggaaggcggaagaggtgcgt
gcgcgttccgaacgcctgccgctgtccgaacttatcgcgctggctggcgacgaaccggcg
cgcggtttcgccgacgcgctgcacgcgaagatcgccgccggtcagccggcggtgatcgcc
gagatcaaaaaggccagcccgagcaagggcctgctgcgcgcggattttcggcccgccgag
atcgcggtcagttatgcccacggcggcgcggcctgtctctcggtgctgaccgatatcgat
ttcttccagggcagcgatgcgtatctgaaggaggcgcgcgcggcctgcgcgttgccggcg
attcgcaaggatttcatcatcgacccctatcaggtccacgaggcccgcgcgatgggcgcc
gactgtatcctgctgatcgcggcctgtctcgacgacgcgagtctgcgcgacttgaacgcg
ctcgcgcaggcgctcggcatggatgtgctggtcgaggtgcatgacgcgctggaactggaa
cgcgcgctggcggtacccggacgcctgatcggcgtcaacaatcggaatctgcggaccttc
gaggtaagcctggagacaaccatcgatctgctcgggcccatccccgccgatcggctgctg
gtcaccgagagcggcattttgagccgcgacgatgtcgcgcgcatgcgcgcgcaaggggtg
aatgcctttctggtcggcgaagccttcatgcgggccgaggatccgggcgccgagttggcg
cggctgtttttcactcccgccggatag

DBGET integrated database retrieval system