KEGG   Thiocystis violascens: Thivi_3706Help
Entry
Thivi_3706        CDS       T02138                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tvi  Thiocystis violascens
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:tvi00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:tvi00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4043411..4043977
Genome map
AA seq 188 aa AA seqDB search
MKVIETALPGVLIIEPRVWGDERGYFLETYQARRYAEHGIPSPMVQDNQSFSRKGVLRGL
HVQHPHAQGKLVQVYAGEVFDVAVDIRRGSPTFGQWVGVTLSGENKRQFWVPPGFAHGFL
VTGDSALFVYKNTDYYSPETEFSVRWDDPDIGIDWPLDGTPELSRKDIDAALLKDIPAER
LPGYEDDT
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcatcgagaccgcgcttccgggcgtgctcatcatcgaacccagagtttggggc
gacgagcgcggctattttctggagacctatcaggccaggcgctatgccgagcatggcatt
ccgtccccgatggttcaggacaatcagtccttctcgcgcaagggcgtgctgcgcgggctc
catgtccagcatccgcatgcgcagggcaagctggtgcaggtctacgcgggcgaggtcttc
gacgtggcggtggatattcgccgcggctcccccaccttcggacaatgggtcggcgtgacc
ctgtccggcgagaacaaacgccagttctgggtgccgcccggattcgcccatggtttcctg
gtgaccggcgacagcgcgctcttcgtctacaaaaacaccgactattacagcccggaaacc
gaattcagcgtgcgctgggatgacccggacatcggcatcgactggccgttggacggaacc
ccggaactctcgcgcaaagacatcgacgcggcgctcctgaaggacatcccggcggagcgc
ctacccggctacgaggatgacacatga

DBGET integrated database retrieval system