KEGG   Thiocystis violascens: Thivi_3725Help
Entry
Thivi_3725        CDS       T02138                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tvi  Thiocystis violascens
Brite
Enzymes [BR:tvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Thivi_3725
Secretion system [BR:tvi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Thivi_3725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4057656..4058390
Genome map
AA seq 244 aa AA seqDB search
MRRFRDFAFAVASLTLATGALAASPEQTIRDTLEKTVPGIKISHIEPAPIKGLYEVMVGT
DLMYVTGDGRYFVNGHIVDLKTREDLTEPRLAEARKLLIDGIGESQMVTFGAADAKHTIT
VFTDIECGYCRKLHSQIDAYGKEGIRVRYLFFPRAGKGSPAYDEAVSVWCAGDDAARRQA
MTDAKAGKTIEAKTCDNPIDAHMALGADLGLRGTPAILTEKGDLIPGYVEPKRLAAELNG
GAGS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagaagattccgtgattttgcctttgccgtggcgtccctgacgctcgccactggcgcc
cttgccgcctcgcccgagcagaccattcgcgacaccctggaaaagaccgtgcccggaatc
aagatcagccatatcgaaccggctccgatcaagggtctgtatgaggtcatggtgggcacc
gatttgatgtacgtgaccggcgatgggcgttatttcgtcaatggccatatcgtcgacctc
aagacccgcgaggatctgaccgagccgcgcctggccgaggcgcgcaagcttctgatcgat
gggattggcgagagtcagatggtgaccttcggcgcggcggacgccaagcacaccatcacc
gtctttaccgacatcgagtgcgggtattgccgcaagctgcacagtcagatcgatgcctat
ggcaaggaaggcatccgtgtccgctatctgttcttcccgcgcgccggcaagggcagcccg
gcttacgacgaggcggtttccgtctggtgcgctggcgacgatgccgcgcgccgtcaggcc
atgaccgatgccaaggccgggaaaacgatcgaggccaagacctgcgataatccgatcgac
gcgcacatggcgctgggcgccgatctcgggttgcgcggcacgcccgccattctgaccgag
aaaggcgatctgatccccggctacgtggagcccaaacgactcgcggccgaactcaatggc
ggggcggggagttga

DBGET integrated database retrieval system