KEGG   Thiocystis violascens: Thivi_3764Help
Entry
Thivi_3764        CDS       T02138                                 

Definition
(RefSeq) 1,4-alpha-glucan-branching protein
Organism
tvi  Thiocystis violascens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4094111..4095940)
Genome map
AA seq 609 aa AA seqDB search
MYETFGAVVQGPRVEFHLFLPDNARDPSQYFRGGSPRIKQIHVRGDFQDAVGSQNWSLDQ
TFKMQRLEHPHGWLYKLAIEQDLNDGYYQYKYFVEFENGTQRWVSDPIAKYGGNDQNENS
AFVIGGRHTVVHPIARRRPPRDLVIYETHLDDFTAAFRHDKTPVDAFRERLDYLQELGVN
AIEFMPWTAWPGSGFSWGYDPVAFFSVENRYVDDPAKPADKLVKLMELINDLHERGMQVI
MDGVFNHVRAGNDPNLGFPYRWLYQVPSDSPFIGAFAGGGFFEEFDYQNNCVAEFIRDVC
LYWLDRFQLDGIRFDYTLGFFRQGDAGVGIAKLIADLHQSLNQTGRSNVALFIEHLTDNR
FEAIRDTNDIGAAGCWFDPFMFKHFEYCRNGNIDSGILRILNANLDFAPGKEPVTYLENH
DHSSIMQEAGGRGRWFKTQPAAIALMTAPGAVMLHHGQEFGQEEWLPGSGDGRVVPRPLR
WEESPLGGDAIGTRLFGLYQRLIAIRQRHPALRSPNFFPFPFNHPEGYGAFPEQDVVIYH
RWGQAEDGGFERFIIVVNYSDFDQRIDIPFATDGHWEDLLNGGVVFVDNQKLRRQKINSN
WGRIYYRKA
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagacattcggtgcggttgtacaaggtccacgagtcgagtttcatctgttcttg
ccggataacgcacgggatccgagtcaatatttccggggcggctctccccgaatcaagcag
atccatgttcgcggtgacttccaggatgcggtcggcagtcagaactggtcactcgaccag
acgttcaagatgcagcggctcgaacacccgcatggttggctgtacaagcttgctatcgag
caggatctgaatgacggctattaccagtacaagtacttcgtcgagtttgagaacgggacg
caacgttgggtctccgatcccatcgccaagtatggcggcaatgaccagaacgaaaattcg
gcctttgtgattggcggtcgccacaccgtcgttcacccgattgcccggcgccgaccccca
cgggatctcgtcatctacgaaacgcatctcgacgacttcaccgccgccttccgccacgac
aagacgccggtcgatgccttccgggagcgcctggattatcttcaggaactcggcgtcaat
gcgatcgaattcatgccctggacggcctggccgggaagcgggttcagttggggctacgat
cccgtcgcgttcttctcggtcgaaaaccgctatgtagacgatccagccaagccggcggat
aagttggtcaaactcatggaattgatcaacgacctgcatgaacgcggcatgcaggtgatc
atggatggcgtgttcaatcatgtgcgggcgggcaacgacccgaacctggggtttccctat
cgctggctgtatcaggtgccatccgactcccccttcattggcgcgttcgccgggggcggt
ttcttcgaggaattcgactaccaaaacaactgcgtcgcggaattcatccgtgatgtctgc
ctctactggcttgaccgcttccaactcgatgggattcgcttcgattacaccctgggcttt
ttccgccagggcgatgccggggtgggaatcgccaaactgatcgccgatctccatcagtct
ctcaaccagacgggtcgctcgaacgtcgccttgttcatcgagcatctgaccgacaatcga
tttgaagcgatccgcgataccaacgacatcggcgccgccgggtgctggttcgatcccttc
atgttcaagcacttcgagtactgccgtaacggcaatatcgattccgggattttgcgcatt
ctcaacgccaacctggactttgcccctggcaaggaacctgtgacctacctcgaaaatcac
gatcattcctcgatcatgcaggaggctggcggacgcgggcgttggttcaagacccaaccc
gcggcgatcgcgctgatgaccgcgccgggagcggtcatgcttcaccatggtcaggagttc
ggccaagaggagtggttgccgggcagcggcgacggtcgggtggtgccgcgaccgctgcgc
tgggaggaaagcccgctgggcggggatgcgatcggcacgcgactctttgggctttaccag
cggttgatcgcgatccgtcagcggcatccggcgctacgctcgccgaacttcttccccttt
cccttcaaccatccggaggggtatggcgcgtttcccgagcaggacgtggttatctatcat
cgctgggggcaggccgaagacggcgggttcgagcgattcatcatcgtcgtcaactactcc
gacttcgatcagcgaatcgacatcccctttgccaccgacggtcactgggaagacctgttg
aatggcggcgttgtcttcgtcgacaaccagaagctccggcgtcaaaaaatcaactcgaac
tgggggcggatctactatcggaaggcatag

DBGET integrated database retrieval system