KEGG   Thiocystis violascens: Thivi_3854Help
Entry
Thivi_3854        CDS       T02138                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tvi  Thiocystis violascens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thivi_3854
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thivi_3854
  Amino acid metabolism
   00310 Lysine degradation
    Thivi_3854
Enzymes [BR:tvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Thivi_3854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4195289..4196542)
Genome map
AA seq 417 aa AA seqDB search
MSREVRVPALPESVADATVAAWHKQPGDQVREGENLVDLETDKVVLEVPSPVDGVLGAIQ
AREGDLVQADAVLGLIESGARKAPGTPRPSVTSPSSRAPLESVAPMNSPPQRPRPGQVIA
PAARRLVKEMNLDPQQIPGSGKDGRIQKTDVVQWLDEREQAAPEHDPDALNLSEAPAPSL
TGEAGRPEQRVPMTRLRARIAERLVQAQQNAALLTTFNEVNLKTVLELREKYKGLFETRY
GTRLGFMSFFVKAAVDALQRFPAINASVDGDDIVYHGYFDIGIAVSSPRGLVVPTLRNCD
QLSMSDIEQGIADFGQKAKDGSLSYEELTGGTFSITNGGVFGSLLSTPILNPPQSAILGM
HKIQERPIVENGQIVIAPMMYLALTYDHRIIDGREAVQFLVAIKEILEDPARLLLRV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgaagtccgcgtccccgcactccccgaatccgtcgccgacgccaccgtcgcg
gcctggcacaaacaacccggcgaccaggtccgggagggcgagaatctggtcgatctcgaa
accgacaaggtcgtgctggaggtgccctcccccgtggacggcgtgctcggcgcgatccag
gcccgcgagggcgatctcgtgcaggccgacgccgtgctcgggctcatcgagtccggcgcg
cgcaaggcgcccggcacgccgcgtcccagcgtcacgtcgccttccagccgggcgccgctc
gaatccgtcgcccccatgaattcgccgccccagcgaccgcgccctgggcaggtaatcgcc
cccgccgcccgccggctggtcaaggagatgaacctggaccctcagcagatccccggcagc
ggcaaggatggccggatccagaagaccgacgtggtgcagtggctggacgagcgcgaacag
gcggcgcccgagcacgacccggacgcgctcaatctcagcgaagcgcccgcccccagtctg
accggcgaggccggacgcccagaacagcgggtgcccatgacccgtctgcgcgcgcgcatc
gccgagcggttggtccaggcgcagcaaaacgccgccctgctgaccaccttcaacgaggtc
aacctcaagacggtgctggaactgcgcgagaagtacaaaggactgttcgagacccgttac
ggcacgcgtctgggcttcatgtccttcttcgtcaaggcggcggtggacgcgctccagcgc
ttccccgccatcaacgcctcggtggacggcgacgacatcgtctatcacggctatttcgac
atcggcatcgccgtcagctccccgcgcggactggtcgtgcccaccctgcgcaactgcgac
cagttgagcatgtccgacatcgaacagggcatcgccgactttggccagaaggcgaaagac
ggcagcctgagctacgaggaactcaccggcggcaccttttccatcaccaacggcggcgtc
ttcggctcgctgctctcgacgcccatcctcaacccgccgcaaagcgcgattctagggatg
cacaagatccaggagcgtcccatcgtggagaatggccagatcgtcatcgcccccatgatg
tatctggccctgacctatgatcatcggatcatcgacggacgcgaggcggtgcaatttctg
gtcgcgatcaaggagattctggaagatccggcaaggttgctgttgcgggtgtag

DBGET integrated database retrieval system