KEGG   Thiocystis violascens: Thivi_3909Help
Entry
Thivi_3909        CDS       T02138                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tvi  Thiocystis violascens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thivi_3909
   01230 Biosynthesis of amino acids
    Thivi_3909
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thivi_3909
   00051 Fructose and mannose metabolism
    Thivi_3909
   00562 Inositol phosphate metabolism
    Thivi_3909
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thivi_3909
Enzymes [BR:tvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thivi_3909
Exosome [BR:tvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thivi_3909
  Exosomal proteins of bladder cancer cells
   Thivi_3909
  Exosomal proteins of melanoma cells
   Thivi_3909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4256873..4257637
Genome map
AA seq 254 aa AA seqDB search
MRQPLIAGNWKMNGTRASAEALLSGVVAGASTISKTEIVVCPPFPFLSLGERLLSGASVK
LGAQNVCTKDVGAYTGEVSAAMLAEFGCCYVICGHSERREYYGETDAIIAEKLTACASQG
MIPILCVGETLQQREQGLTEDVIAGQLDGVISQIGIDAFHQAEIAYEPVWAIGTGMTATP
EQAQDVHAFIRQRIAERSQTIAEKIRILYGGSMKAANARDLLSQADIDGGLIGGASLVAA
DFLAICQAGDLVAG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagccattgatcgcgggaaactggaaaatgaacggcaccagggcgagcgccgaa
gcgctgttgtctggtgtggttgctggcgcgtcgacgatctccaaaacggaaatcgtggtt
tgcccgccgtttccgtttctgtctctcggtgaacgattgctttccggcgcgtcggtgaaa
ctcggcgcgcagaatgtctgcaccaaggatgtcggcgcctacacgggtgaagtgtccgcc
gctatgctggccgaattcggttgttgctatgtcatctgcggtcattccgagcgccgcgaa
tattatggcgaaacggacgcgatcatcgcggaaaagctgaccgcctgcgcgagtcagggt
atgatccccattctctgcgtcggcgaaaccctgcaacagcgtgagcagggactgacagaa
gacgtgattgccggtcagctcgacggtgttatcagtcaaattgggatcgatgcgttccat
caggccgagattgcctatgaaccggtctgggcgattggcacggggatgactgcgactccc
gagcaggctcaggatgtgcatgcgttcatccgtcagcggatcgcggaacgcagtcaaacg
attgccgagaagatccggattctctatggcggcagcatgaaagccgcgaatgcccgcgat
ctgctgtcgcaagccgatatcgatggaggcctgatcggtggagcttctctggttgctgct
gattttctagcgatctgtcaggctggcgatctggtggcgggctaa

DBGET integrated database retrieval system