KEGG   Thiocystis violascens: Thivi_4350Help
Entry
Thivi_4350        CDS       T02138                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tvi  Thiocystis violascens
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thivi_4350
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thivi_4350
   00650 Butanoate metabolism
    Thivi_4350
  Energy metabolism
   00190 Oxidative phosphorylation
    Thivi_4350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4726636..4726986)
Genome map
AA seq 116 aa AA seqDB search
MSRQASGLMAWLIQRTTAVYLALFLGYLLLHFTFNAPADHAALLAWVNQAPVAIGLLLCV
PLLLAHAWVGIRDVLIDYVHALGLRIGLMMLFGFVFIASGLWVFKAIVTAGLRGYA
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgagccgacaagcctccggactcatggcctggttgattcaacgcaccacggccgtctat
ctcgcgctcttcctgggctatctgctgcttcattttaccttcaacgcaccggcggaccat
gcggcgctgttggcctgggtcaatcaagcgccggtcgccatcggtctgctgctgtgcgta
ccgctgctgctggcgcatgcctgggtcggcattcgcgacgtgctgatcgactatgtgcac
gcgctcggtttgcgcatcggcttgatgatgctgtttggcttcgtttttattgcctccgga
ctctgggtcttcaaggcgatcgtcaccgcgggtctgaggggttacgcatga

DBGET integrated database retrieval system