KEGG   Thiocystis violascens: Thivi_4478Help
Entry
Thivi_4478        CDS       T02138                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tvi  Thiocystis violascens
Brite
Enzymes [BR:tvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Thivi_4478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4839785..4840519)
Genome map
AA seq 244 aa AA seqDB search
MKPLLLASLLCLAIGSGACARDDDMSDARNRLIEQIENEVRMTARELGVNGLDPRVADAL
RRVPRERFVPESERHLAYRNHPLPIGDGQTISQPYIVAIMSQLLAVGPGDRVFELGTGSG
YQAAVLAALGVEVYSVEIVPELAARAAATLAALGEDKVRVRAGDGWLGWPEAAPFDGIIV
TAAAPSLPRHLIDQLKPDGRLVIPMGGVDTIQQLALFEKDADGRLQRRNLIDVRFVPVTG
SMAP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccactccttctcgcgtcgctgctgtgtctcgccatcggaagcggcgcctgtgca
cgggacgacgacatgagcgatgcgcgcaaccggttgatcgagcagatcgaaaacgaggtt
cggatgaccgcgcgcgagttgggcgtcaacgggctcgatccccgggtcgccgacgccctg
cgccgggtaccgcgcgagcgtttcgtccccgagtcggaacgccatctcgcctatcgcaac
catccgctccccatcggcgacggacagaccatctcccagccctatatcgtcgccatcatg
agccaactgctggcggtcggcccgggcgatcgggtgttcgagctggggaccggttccggt
tatcaggccgccgtcctggccgccctgggcgtcgaggtctactcggtggaaattgtgccg
gaactggccgcgcgggccgccgcgacactcgcggcgcttggcgaggacaaggtccgggtg
cgcgcgggcgacggctggcttggctggcccgaggcggcccccttcgatggcatcatcgtc
accgccgccgcgccctcgttaccgcgccacctgatcgatcaactcaaaccggacggtcgg
ctagtgattccgatgggcggcgtcgacacgattcaacagttggcgctgttcgagaaggac
gcggacggacgcttgcaacgtcgcaacctgatcgatgtccgcttcgtcccggtgacggga
tccatggccccttga

DBGET integrated database retrieval system