KEGG   Thiocystis violascens: Thivi_4581Help
Entry
Thivi_4581        CDS       T02138                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tvi  Thiocystis violascens
Pathway
tvi00010  Glycolysis / Gluconeogenesis
tvi00052  Galactose metabolism
tvi00500  Starch and sucrose metabolism
tvi00520  Amino sugar and nucleotide sugar metabolism
tvi00521  Streptomycin biosynthesis
tvi01100  Metabolic pathways
tvi01110  Biosynthesis of secondary metabolites
tvi01120  Microbial metabolism in diverse environments
tvi01130  Biosynthesis of antibiotics
tvi01200  Carbon metabolism
Module
tvi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tvi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thivi_4581
   00052 Galactose metabolism
    Thivi_4581
   00500 Starch and sucrose metabolism
    Thivi_4581
   00520 Amino sugar and nucleotide sugar metabolism
    Thivi_4581
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thivi_4581
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thivi_4581
Enzymes [BR:tvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thivi_4581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AFL76373
UniProt: I3YHA5
Position
4961515..4962495
Genome map
AA seq 326 aa AA seqDB search
MRLLVGDIGGTKTALGVAQTDGETVTLTEPRRYPSAAFESLDQIVRRYCGETGLICRFAA
FAVAGPIQDRRCETTNLPWILDADELEHSFGFAGVDLLNDLEAVAWGVDALGPQDLAVIH
PGDGIGTGNACVVAAGTGLGQAGLYWDGVRHHAFATEGGHTDFAPADDLEFALLTHLKAR
FGRVSWERVVSGMGIANLYEFLLVHRGAEPPAWLRQAIAEGGDTAAAVAQAAADDRCPLC
VETMGLFMRLYGREAGNLALKQMALGGVFLGGGIALKNLSALRNGQFLEGFFDKGRMEPL
MRRMPVCVILQPHTPLLGAARFMASQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttactggtgggtgacatcggtggaaccaagacggcactcggcgtcgcccagacc
gatggcgagaccgtgacgctgactgaacccaggcgttacccgagcgcggccttcgagtcg
ctcgatcagatcgtgcgccgctattgcggggaaacggggttgatctgtcgtttcgcggcc
ttcgcggtcgccggtcccattcaggatcgtcgttgcgagaccacgaatctgccctggatc
ctggatgccgacgaactggaacactcgttcgggtttgccggcgtcgatcttttgaacgat
ctggaggcggtcgcctggggcgtggacgcgctcgggcctcaggatctggccgtgatccat
cccggcgatgggatcggcacgggcaatgcctgcgtggtggccgccgggaccgggctcggt
caggctggcctgtattgggatggcgtgcggcatcatgcctttgcgaccgagggcggacat
accgatttcgcgcccgccgacgacctggaattcgcgctcctgacccatctgaaggcgcgt
ttcggacgggtgagttgggagcgcgtggtatcggggatgggaatcgccaatctctacgag
tttctgctggtccatcgtggcgccgagccgccggcctggctgaggcaggcgattgccgaa
ggaggcgataccgccgccgcggtcgcgcaggcggcggccgatgatcgttgcccgctctgc
gtcgagaccatgggcctgttcatgcgtctgtatggacgtgaggcggggaatctggccttg
aaacaaatggccctgggcggcgtctttctggggggcggcattgccttgaagaatctgtcg
gccttgcgcaacgggcagtttcttgagggttttttcgataagggccggatggaaccgctg
atgcgccggatgccggtctgcgtcatcctgcaaccccacactcctttactgggcgcggcg
cgtttcatggcctcgcaataa

DBGET integrated database retrieval system