KEGG   Thermoplasma volcanium: TVN0071Help
Entry
TVN0071           CDS       T00042                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TVN0071
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVN0071
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TVN0071
Enzymes [BR:tvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TVN0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70571..71521
Genome map
AA seq 316 aa AA seqDB search
MEELLNSETKPPGRTPTIKAYALGKELRLNNLFLKFEGANATGTQKDRISEAHVLNAIRD
GYNGIAVGTCGNYGASIAYYANLYGIKSYIGMPSAYTHDREDFMLSSNAEILYYNGKYEE
TVSFIHDYATDNSLYDASPGSDHSYIDTKMYAGIAFEIYEAILKVPDYVIVPVGNGTTLS
GIYEGFHLMYLNGTIDRMPRMVGVSTRGGNPIVSSWKRGYKKVVDLDPARIRETAVNEPL
VSYRSFDGDKALAAIRETHGKALYVSDDEMVRFSELMYREEGLNPLPASASAVAALVHLH
LNPDDYVVSVITGRRM
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaagagctacttaattccgaaacaaagcccccggggcgtacgcccacaataaaagcg
tatgcacttgggaaggagctccgtttaaacaatctttttttgaagtttgaaggagctaat
gcaactggaacgcagaaggatcgcatatctgaagcccacgttctcaatgcaataagggac
ggctataatggcattgctgttggcacatgtggaaactacggggcctcaatagcttactat
gcaaacctttacggcattaagtcctacataggtatgccatctgcatatacgcacgaccgc
gaggacttcatgctttcttcgaacgctgagatactatattacaacgggaagtacgaggaa
acggtatcctttatacatgattatgctacagacaatagcctgtacgatgccagccctggt
tcggatcactcatacatcgatacaaagatgtatgcaggtatagcatttgagatatacgag
gcgatattaaaggtacctgactatgttatcgttccagtgggaaacggcactactctctct
ggcatatacgagggatttcatcttatgtacttgaacggcacaatcgacaggatgccgagg
atggtaggcgtcagtacgcgtggcggcaacccgatagtgtcctcatggaagaggggctat
aagaaggtagtcgatttggatccagcacgcattagggagaccgctgtgaacgaacctctg
gtatcttacagatcctttgatggcgataaggccctagcggcaataagagaaacgcatggt
aaggctctttatgtatctgacgatgaaatggtaaggttctcagagcttatgtacagggaa
gagggccttaacccgcttcctgcttccgcttcagctgtggccgctctggtacacctgcac
ttaaatcctgacgattatgttgtttctgtaataacggggaggaggatgtaa

DBGET integrated database retrieval system