KEGG   Thermoplasma volcanium: TVN0071Help
Entry
TVN0071           CDS       T00042                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TVN0071
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVN0071
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TVN0071
Enzymes [BR:tvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TVN0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70571..71521
Genome map
AA seq 316 aa AA seqDB search
MEELLNSETKPPGRTPTIKAYALGKELRLNNLFLKFEGANATGTQKDRISEAHVLNAIRD
GYNGIAVGTCGNYGASIAYYANLYGIKSYIGMPSAYTHDREDFMLSSNAEILYYNGKYEE
TVSFIHDYATDNSLYDASPGSDHSYIDTKMYAGIAFEIYEAILKVPDYVIVPVGNGTTLS
GIYEGFHLMYLNGTIDRMPRMVGVSTRGGNPIVSSWKRGYKKVVDLDPARIRETAVNEPL
VSYRSFDGDKALAAIRETHGKALYVSDDEMVRFSELMYREEGLNPLPASASAVAALVHLH
LNPDDYVVSVITGRRM
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaagagctacttaattccgaaacaaagcccccggggcgtacgcccacaataaaagcg
tatgcacttgggaaggagctccgtttaaacaatctttttttgaagtttgaaggagctaat
gcaactggaacgcagaaggatcgcatatctgaagcccacgttctcaatgcaataagggac
ggctataatggcattgctgttggcacatgtggaaactacggggcctcaatagcttactat
gcaaacctttacggcattaagtcctacataggtatgccatctgcatatacgcacgaccgc
gaggacttcatgctttcttcgaacgctgagatactatattacaacgggaagtacgaggaa
acggtatcctttatacatgattatgctacagacaatagcctgtacgatgccagccctggt
tcggatcactcatacatcgatacaaagatgtatgcaggtatagcatttgagatatacgag
gcgatattaaaggtacctgactatgttatcgttccagtgggaaacggcactactctctct
ggcatatacgagggatttcatcttatgtacttgaacggcacaatcgacaggatgccgagg
atggtaggcgtcagtacgcgtggcggcaacccgatagtgtcctcatggaagaggggctat
aagaaggtagtcgatttggatccagcacgcattagggagaccgctgtgaacgaacctctg
gtatcttacagatcctttgatggcgataaggccctagcggcaataagagaaacgcatggt
aaggctctttatgtatctgacgatgaaatggtaaggttctcagagcttatgtacagggaa
gagggccttaacccgcttcctgcttccgcttcagctgtggccgctctggtacacctgcac
ttaaatcctgacgattatgttgtttctgtaataacggggaggaggatgtaa

DBGET integrated database retrieval system