KEGG   Thermoplasma volcanium: TVN0153Help
Entry
TVN0153           CDS       T00042                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tvo  Thermoplasma volcanium
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tvo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(162982..164004)
Genome map
AA seq 340 aa AA seqDB search
MDGLIIPRRGAYKQEDGKYLFEVISEREPPVEHQTILENGIKKYIVKLDQSALKDLMRYY
SVFPSYEDQAAERIFAGLDEKPIKPKIMGIINATPDSFYSGSRVLGNEDLIFKIIDEKPD
IVDVGAESTRPGSKPVDPTKEYERLLPVIKIIRDYSDIPVSIDSRHPSVIKNLVKYEINY
INDISGFTNKEMIDLAKDSSLYCVVMHMRGSPQDMQNFTNYDDVIVDVIGFLLDRANNLL
ANDVAFGRIISDPGIGFAKDLKGNIEILRNIKSFHIGMPLLVGTSRKTFIGTITGQAVEG
RLPGTIGTSIYLANNRVSIIRVHDVRENKDAINTYLSLAQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggacggcctcataataccgagaaggggtgcatacaagcaggaggatggcaaatacctt
ttcgaggtcatatctgagagagagccgcctgtggaacaccagactatactggaaaacgga
ataaaaaagtatatagtaaagctagatcagtctgccctaaaggatctaatgcggtattat
tcagtattccctagttacgaagatcaggcagcggaaagaatttttgctgggctggatgaa
aaacccataaaaccaaagatcatgggcataataaacgcaactccagactcattttattct
ggaagccgcgtactgggaaacgaagaccttattttcaagatcatagacgagaagccagat
attgttgatgtaggtgcagaaagcacaaggcctggaagcaagcctgtggatcctacaaaa
gaatatgagaggctgctgccggtcataaaaataataagggattattcagacatacctgtg
tctatagattctaggcatccttccgtaataaaaaatcttgtaaagtatgaaataaactac
ataaatgatatatcaggctttaccaacaaggagatgatagatctagcgaaggattcaagc
ctatactgtgttgtcatgcacatgaggggatctccacaagacatgcagaactttacaaac
tatgatgatgttatagttgacgtcataggtttcttgctagatcgagcaaacaacctactg
gctaatgatgtcgcttttggaagaataataagcgatcctgggataggttttgcaaaagat
ctgaaaggcaatattgaaatattgaggaatatcaaaagctttcacatcggtatgcccctg
ctcgtaggaacttcgaggaaaacgtttatcgggacaataacaggccaggccgttgagggc
aggctgccaggaaccatcggtactagtatataccttgcaaacaacagagtatcgataatc
agagtgcatgacgttagggaaaataaagatgcgataaatacgtacctatcgttggcacaa
taa

DBGET integrated database retrieval system