KEGG   Thermoplasma volcanium: TVN0274Help
Entry
TVN0274           CDS       T00042                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tvo  Thermoplasma volcanium
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVN0274 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TVN0274 (sucC)
   00640 Propanoate metabolism
    TVN0274 (sucC)
   00660 C5-Branched dibasic acid metabolism
    TVN0274 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TVN0274 (sucC)
Enzymes [BR:tvo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TVN0274 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(285047..286144)
Genome map
AA seq 365 aa AA seqDB search
MNLYEYMGKDIFREYGIPVPNGYVVSSPQDVKKFTNPVAVKSQILLGGRGKAGGIKFAKT
DEELKNAVSTLLSTKVRNMTVTKVLIEDMLNIKHEYYVSIALNRAAKSPMLIASAMGGME
IENVPDDKIFKRIIDPSLGYSDFIGREASQFMGLPPELSKQFLDILKKLYNVYRGEDCEL
VEINPLVETGDGKLIAADAKVVIDSDAIYRHREFSIQDPEKTPLELKAEGKGYAFVELDG
DIGVIANGAGLTMATLDALLLHKGKPRNFLDLGGTDNVDIVINAFDLVLEAKPKAILVNI
FGGVTKCDTVAQGIVEAKKKFDIKIPVVVRLSGVHEVEGRKILQDNGIEAFSEMMPAIER
VTKVF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
ttgaatctttatgagtacatgggaaaagatatattccgcgaatacggaatccccgtacct
aatgggtacgtcgtctcaagtccacaagatgtaaagaagttcacaaaccctgttgctgtt
aagtctcaaatacttcttggcgggagaggaaaggctggagggattaaatttgcaaagacg
gatgaagagctaaagaacgctgtaagcaccctgctctcaacaaaagtgaggaacatgacg
gtgactaaggttctcatagaggatatgctaaacataaagcacgaatactatgtcagtata
gccttaaacagggccgcaaagtcacctatgctaattgcaagcgccatgggtggcatggag
atcgagaatgtgcccgatgacaagatattcaagaggatcatagacccatcccttggatat
tccgactttataggaagggaggcctctcagtttatgggccttcctccagaactctcaaag
cagttcctagatatacttaagaaattatacaacgtctatagaggggaggactgcgagctt
gttgaaataaatccactagtcgaaacaggcgacggaaagcttatagcagctgatgccaag
gtagttatagattcagacgctatatatcggcatcgcgagttcagtatacaagatccggag
aaaacaccccttgagcttaaagctgaggggaaaggatacgcctttgtagaactggacggc
gatataggggtcattgcaaacggtgccggcctaacaatggcgacgcttgacgcccttctt
cttcataaaggtaaaccaaggaacttccttgatcttgggggtacagataacgtagacatt
gtgataaatgcctttgatcttgtattagaggctaagcccaaggcaatactggtaaacata
tttggcggtgtaactaagtgtgatactgtagcccagggtatagtagaggccaagaagaaa
ttcgatataaaaataccagtggtcgttaggctaagtggagttcacgaagtagagggaagg
aagattcttcaggataacggaatcgaagccttctcggaaatgatgcccgcaatagagagg
gtaacgaaggtgttttaa

DBGET integrated database retrieval system