KEGG   Thermoplasma volcanium: TVN0396Help
Entry
TVN0396           CDS       T00042                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:tvo01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tvo00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:tvo00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:tvo00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:tvo00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:tvo00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385927..387048
Genome map
AA seq 373 aa AA seqDB search
MWYFRTPRIIFGEDSLSFLDDHSSSKILVVTDNFLSNTPILKEVLSHLSGKDIKVFSEIS
PEPRLSEILKGRELASRLDPDTIIGLGGGSSMDAAKILFALHEMPDLSPFDISPINSIKL
HQKSELIEIPTTSGTGSECSWAAVFSDDTEERKNEIASPEIMADYAILDPKLVLDLPKGI
TVNTATDAITHAIEAYTSQWRNPYSDAMAEKALDLILNNLPTVLVNPKDINARNSVHIGA
SMAGISFSNSQIGLAHALGHALGAIFKTPHGESVGLYLPHVTEFNYEAAKDRYDKINSFF
PDEYRTDKVWETIRSYLNAIGQVTNVSEAGIERSKYEKELGKIVSLASESTGVITNARDA
STKDIENIARSIL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgtggtattttagaacaccaaggataatctttggcgaagattcattgtcctttctagac
gatcatagttcttctaagatacttgttgtaactgataattttctatcaaatacgccaatt
cttaaagaagttctttctcatctatcaggcaaggacattaaagtattttctgagataagt
ccagaaccaagactgtctgaaatattgaaaggccgagagctagcatccagattagatccg
gacactatcatcggtcttgggggtggttcatcaatggatgcagccaaaatattatttgca
ttgcacgaaatgcctgatctctctccatttgatatttcgccaataaatagcattaagctg
catcagaaaagcgaacttatagaaatacctacaactagtggcacgggttccgaatgttcc
tgggcagctgttttttcagatgatacggaagaaagaaaaaatgaaatagcttcacctgag
ataatggctgactacgctatactggatccgaaattagtcttggatttgcctaagggtata
acggtaaacaccgctacggatgctataacccatgcaattgaagcctatacaagccaatgg
aggaacccttattctgatgctatggctgaaaaggccctagatcttattctgaataatttg
cccaccgttctggtaaatccgaaggacatcaatgctagaaacagcgtccacataggcgcg
tctatggcaggaattagtttttcaaattcacagataggccttgcacatgcccttgggcat
gcacttggcgcaatcttcaagacaccgcatggtgagagcgttggcttataccttcctcat
gttactgaattcaattatgaagcagcaaaggatagatacgacaaaataaatagtttcttc
cctgatgagtatcgaacggataaggtgtgggaaaccatcaggagctatctcaatgctata
gggcaggttactaatgtatcggaagctggaatagaacgaagcaaatatgaaaaggaatta
ggcaagatagtttcactcgcatccgaatcaactggggttataacaaacgctcgtgatgca
agtacgaaggatattgaaaatattgcgaggtccattctatga

DBGET integrated database retrieval system