KEGG   Thermoplasma volcanium: TVN0396Help
Entry
TVN0396           CDS       T00042                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TVN0396
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVN0396
  Lipid metabolism
   00071 Fatty acid degradation
    TVN0396
  Amino acid metabolism
   00350 Tyrosine metabolism
    TVN0396
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TVN0396
   00626 Naphthalene degradation
    TVN0396
Enzymes [BR:tvo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TVN0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385927..387048
Genome map
AA seq 373 aa AA seqDB search
MWYFRTPRIIFGEDSLSFLDDHSSSKILVVTDNFLSNTPILKEVLSHLSGKDIKVFSEIS
PEPRLSEILKGRELASRLDPDTIIGLGGGSSMDAAKILFALHEMPDLSPFDISPINSIKL
HQKSELIEIPTTSGTGSECSWAAVFSDDTEERKNEIASPEIMADYAILDPKLVLDLPKGI
TVNTATDAITHAIEAYTSQWRNPYSDAMAEKALDLILNNLPTVLVNPKDINARNSVHIGA
SMAGISFSNSQIGLAHALGHALGAIFKTPHGESVGLYLPHVTEFNYEAAKDRYDKINSFF
PDEYRTDKVWETIRSYLNAIGQVTNVSEAGIERSKYEKELGKIVSLASESTGVITNARDA
STKDIENIARSIL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgtggtattttagaacaccaaggataatctttggcgaagattcattgtcctttctagac
gatcatagttcttctaagatacttgttgtaactgataattttctatcaaatacgccaatt
cttaaagaagttctttctcatctatcaggcaaggacattaaagtattttctgagataagt
ccagaaccaagactgtctgaaatattgaaaggccgagagctagcatccagattagatccg
gacactatcatcggtcttgggggtggttcatcaatggatgcagccaaaatattatttgca
ttgcacgaaatgcctgatctctctccatttgatatttcgccaataaatagcattaagctg
catcagaaaagcgaacttatagaaatacctacaactagtggcacgggttccgaatgttcc
tgggcagctgttttttcagatgatacggaagaaagaaaaaatgaaatagcttcacctgag
ataatggctgactacgctatactggatccgaaattagtcttggatttgcctaagggtata
acggtaaacaccgctacggatgctataacccatgcaattgaagcctatacaagccaatgg
aggaacccttattctgatgctatggctgaaaaggccctagatcttattctgaataatttg
cccaccgttctggtaaatccgaaggacatcaatgctagaaacagcgtccacataggcgcg
tctatggcaggaattagtttttcaaattcacagataggccttgcacatgcccttgggcat
gcacttggcgcaatcttcaagacaccgcatggtgagagcgttggcttataccttcctcat
gttactgaattcaattatgaagcagcaaaggatagatacgacaaaataaatagtttcttc
cctgatgagtatcgaacggataaggtgtgggaaaccatcaggagctatctcaatgctata
gggcaggttactaatgtatcggaagctggaatagaacgaagcaaatatgaaaaggaatta
ggcaagatagtttcactcgcatccgaatcaactggggttataacaaacgctcgtgatgca
agtacgaaggatattgaaaatattgcgaggtccattctatga

DBGET integrated database retrieval system