KEGG   Thermoplasma volcanium: TVN0498Help
Entry
TVN0498           CDS       T00042                                 

Definition
RNA polymerase II complex ELP3 subunit
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tvo  Thermoplasma volcanium
Brite
Enzymes [BR:tvo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TVN0498
Transfer RNA biogenesis [BR:tvo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TVN0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
483803..485350
Genome map
AA seq 515 aa AA seqDB search
MDFFSEIREKLLNGEIESKEELEDLKVELSRKYHLDYVPGDVEILNSYEFDDDVKSMLRR
KPTRTISGVSVVAAMTSPDRCPHGKCIFCPGGVDNNSPQSYTGFEPAALRGRNNRYDPYM
ETFSRIKQLETIGHDTSKIDLIVMGGTFTARPVDYQNSFIKGCLDAMNGYISNDLYQAIK
INETSEHRCIGLTVETKPDWFFEKEIDDALNYGTTKVELGVQNINDRILRINNRGHTVED
IARSTQLARDAGLKIVYHIMPGMYGSSPSLDRESFLLMVNDERFKPDMLKIYPTLVTKGT
ALYNLWKNGKYRPYTTEETVELIVDFMKMMPPWIRVQRIQRDIPVQFIVAGVKRSDLRNL
VEERIRKEGTKTREIRYREIGHYNGSVENIHLSVDKYEAAGGTEYFISYVTDDDHIVGFV
RLRQPSEMAHRQEMLGSAIVRELKVFGQEVPVGRRDLKNWQHHGYGMRLMEEAERIARDD
LGLDRILVISGIGVRQYFRKIGYEDLGPYVAKSLK
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggattttttctccgaaatcagggagaaactgttaaacggcgagattgaaagcaaagag
gaactcgaagatctaaaggtagagctgtctaggaagtaccatcttgattatgttcctgga
gatgttgaaattttaaattcgtacgagttcgatgacgatgtaaagagcatgttgaggaga
aagcctacaagaacgatatctggggtttctgttgttgcagctatgacatcaccggatcgc
tgtcctcatggaaaatgcatcttctgcccaggcggagtagacaacaattcaccacaatca
tatactggatttgagccagcagcccttcgcggaaggaacaataggtacgatccgtacatg
gagacctttagcaggatcaagcaactggaaactatcggtcacgatacttcaaagatagac
ctcatagtaatgggcggcacgttcactgcaaggcctgttgactatcaaaattcatttata
aagggatgtctggatgctatgaacggatacatatccaacgatctgtatcaggcaataaag
ataaacgagacgagtgaacatagatgcataggccttactgttgagacaaagccagactgg
ttctttgagaaggagatagatgatgccctgaattacgggactactaaggtagaattagga
gttcaaaatataaacgatcgcatactccgcattaacaacagggggcatacagtagaggac
atagcccgttccacacagctcgccagagatgcagggcttaagatcgtataccatataatg
cctggtatgtatggttcaagcccttcactagatagggaatcattcttgcttatggttaac
gatgaacgttttaagccagatatgttgaaaatatatccaactctggttacaaagggcacg
gctctatacaacctgtggaaaaatggaaagtataggccatatacaaccgaagagacggtc
gaattaatagttgacttcatgaagatgatgccgccgtggataagggtgcaaaggatacaa
agagacatacctgttcagtttattgtagccggtgttaagagatcagatctaaggaaccta
gtggaagaaagaattaggaaggaaggtacaaaaactagggagataaggtaccgtgaaata
ggacattacaacggaagcgttgaaaacatccatcttagtgttgacaagtatgaggctgca
gggggcacggaatattttatctcctatgtgaccgatgacgatcatatagttggtttcgta
aggttgagacagccatccgaaatggcgcatagacaagagatgcttggatctgcaatagtt
cgtgagctcaaggtgttcgggcaggaggtgccggtaggccgcagagacttaaagaattgg
cagcatcatggctatggcatgcgattaatggaagaagcagaaaggatagcgagggatgac
cttggcttggatcgtatactggtaataagcggtataggagtaaggcagtacttcaggaag
ataggatatgaagacctagggccgtacgttgcaaaatctttaaagtaa

DBGET integrated database retrieval system