KEGG   Thermoplasma volcanium: TVN0630Help
Entry
TVN0630           CDS       T00042                                 

Definition
Mg-chelatase, I and D subunits
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tvo  Thermoplasma volcanium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tvo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
621603..623447
Genome map
AA seq 614 aa AA seqDB search
MDRLLFPFSAVVGEDDLKEALLINAVNPRIGGVLIRGPKGVAKSTIARSLIDILPEIDVV
KDCPFKCDPDDYESMCDECRIKYEKGQIVRDRRKMPFVDLPVSATIDRVIGSIDISKAVN
EGIKALQPGLLADANRGIIYIDEVNLLDDSVIDAILDAAASGINVVEREGVSIVHPAKFI
LIGTMNPEEGDLRPQLRDRFGLSVDAVQPDSPDELITISDRVEEYDANPRAFAEKYRRDQ
EKLRASVIEARRILPEVTISNDLKRYIANVVIKLNAGNRAMITAIKASKAIAALAGRKKV
NIEDVERALYLTLKHRVQDKSMIKGTIEKESRFLKTASYEAGSESGKENSPSPNGNNRDK
PQPSENEVLERRVSASFNESGSTSGRAGVADIIRNLDYNRTGTVFNAYETLVKMALNHDN
RIKPEDVVMTKATSRSSLPVILALDASRSMETMKRIAIARGIARDFLKSAYRMRVKMSYL
TFSGSDTAVRVEMTRDIGRIEEEIMHTVAKGKTPLPSALKKMYEISSRYRKRTVSILITD
GRANVPINRSVEEDLRYWSKKLGLKSDLFLISSTMGSEQFIPTYNNDICSYSRGRLIELN
SNGDLSIHSGYRKF
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggataggctcctatttccgttttcagctgttgtaggcgaagatgatctgaaggaggcc
ctgttgataaatgcggtaaatcctaggataggtggagtccttataagggggccaaagggc
gtagcgaaatccaccatagcaagatcccttatcgacattttgccagagatagatgttgtt
aaggattgcccgttcaaatgcgacccggacgattatgaaagcatgtgcgatgagtgtcgc
ataaaatacgaaaaagggcagatcgttagggataggcgaaagatgcctttcgtggacctt
ccggttagtgcaacaattgatagagttataggcagtatagatatttccaaggctgtaaat
gaagggattaaggcccttcagccagggctattggctgacgcaaatagggggataatatat
atagacgaggtaaatctgctcgatgattctgtcattgatgctattcttgatgcggcagca
tcaggaataaacgtggttgaacgggagggtgtgtctatagtccatccggcaaaatttatc
ttgataggtactatgaacccagaagaaggagacttaaggcctcagttaagggatagattt
gggctttctgtggatgctgttcagccagattcacccgacgagctcataacgatatcagat
agggtagaggaatacgatgcgaatcccagagcttttgcggagaagtatcgtagggatcag
gaaaaacttagagcatcagttatagaggcaaggcgtattcttcccgaggtcaccatatcc
aatgacttgaagcgatatatagcaaacgttgtaattaagttaaacgctggaaacagggca
atgataaccgctattaaagcctctaaagcgatagctgcacttgccggaagaaaaaaagta
aatatagaagatgtagaaagagctttatatcttactttaaagcacagagttcaggacaaa
agtatgataaagggcactattgaaaaggagtcaaggttccttaaaacagcatcctatgag
gcaggttccgaatctggtaaggagaatagcccttcccctaatggaaacaatagagacaag
cctcaaccttctgaaaatgaggtattggagagaagagtatccgcttctttcaatgaaagt
ggatcaacttccggcagggcgggggtagccgacataataagaaaccttgactataacagg
acaggaacagtttttaacgcctacgaaactctcgttaagatggctctgaaccacgacaat
cgcataaagccggaggatgttgtaatgaccaaagcaacatccaggtcttcacttccagtt
atacttgcacttgatgcaagcagatctatggaaaccatgaagagaatagcgatagcccgt
ggcattgcaagggactttttgaagtctgcatatagaatgagagtgaaaatgtcctatctc
acgttttctggctcagatacagctgtacgagtggaaatgacaagagatatcggaaggata
gaagaggagattatgcacactgtagcaaaagggaagactccactcccatctgcgctcaag
aagatgtacgaaatctcttcaaggtacagaaaacgcacagtatctattcttataacagat
ggcagggcaaacgtacccataaacaggtcagttgaagaggatttaagatactggtccaag
aaacttggcctaaaaagcgacctgttcctaatttcttctaccatgggaagcgaacaattt
atacctacctataacaatgacatatgcagctattctcgaggcaggctcatagagcttaac
agcaatggcgatttaagcattcactctggatacagaaaattttaa

DBGET integrated database retrieval system