KEGG   Thermoplasma volcanium: TVN0630Help
Entry
TVN0630           CDS       T00042                                 

Definition
Mg-chelatase, I and D subunits
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tvo  Thermoplasma volcanium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TVN0630
Enzymes [BR:tvo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     TVN0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
621603..623447
Genome map
AA seq 614 aa AA seqDB search
MDRLLFPFSAVVGEDDLKEALLINAVNPRIGGVLIRGPKGVAKSTIARSLIDILPEIDVV
KDCPFKCDPDDYESMCDECRIKYEKGQIVRDRRKMPFVDLPVSATIDRVIGSIDISKAVN
EGIKALQPGLLADANRGIIYIDEVNLLDDSVIDAILDAAASGINVVEREGVSIVHPAKFI
LIGTMNPEEGDLRPQLRDRFGLSVDAVQPDSPDELITISDRVEEYDANPRAFAEKYRRDQ
EKLRASVIEARRILPEVTISNDLKRYIANVVIKLNAGNRAMITAIKASKAIAALAGRKKV
NIEDVERALYLTLKHRVQDKSMIKGTIEKESRFLKTASYEAGSESGKENSPSPNGNNRDK
PQPSENEVLERRVSASFNESGSTSGRAGVADIIRNLDYNRTGTVFNAYETLVKMALNHDN
RIKPEDVVMTKATSRSSLPVILALDASRSMETMKRIAIARGIARDFLKSAYRMRVKMSYL
TFSGSDTAVRVEMTRDIGRIEEEIMHTVAKGKTPLPSALKKMYEISSRYRKRTVSILITD
GRANVPINRSVEEDLRYWSKKLGLKSDLFLISSTMGSEQFIPTYNNDICSYSRGRLIELN
SNGDLSIHSGYRKF
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggataggctcctatttccgttttcagctgttgtaggcgaagatgatctgaaggaggcc
ctgttgataaatgcggtaaatcctaggataggtggagtccttataagggggccaaagggc
gtagcgaaatccaccatagcaagatcccttatcgacattttgccagagatagatgttgtt
aaggattgcccgttcaaatgcgacccggacgattatgaaagcatgtgcgatgagtgtcgc
ataaaatacgaaaaagggcagatcgttagggataggcgaaagatgcctttcgtggacctt
ccggttagtgcaacaattgatagagttataggcagtatagatatttccaaggctgtaaat
gaagggattaaggcccttcagccagggctattggctgacgcaaatagggggataatatat
atagacgaggtaaatctgctcgatgattctgtcattgatgctattcttgatgcggcagca
tcaggaataaacgtggttgaacgggagggtgtgtctatagtccatccggcaaaatttatc
ttgataggtactatgaacccagaagaaggagacttaaggcctcagttaagggatagattt
gggctttctgtggatgctgttcagccagattcacccgacgagctcataacgatatcagat
agggtagaggaatacgatgcgaatcccagagcttttgcggagaagtatcgtagggatcag
gaaaaacttagagcatcagttatagaggcaaggcgtattcttcccgaggtcaccatatcc
aatgacttgaagcgatatatagcaaacgttgtaattaagttaaacgctggaaacagggca
atgataaccgctattaaagcctctaaagcgatagctgcacttgccggaagaaaaaaagta
aatatagaagatgtagaaagagctttatatcttactttaaagcacagagttcaggacaaa
agtatgataaagggcactattgaaaaggagtcaaggttccttaaaacagcatcctatgag
gcaggttccgaatctggtaaggagaatagcccttcccctaatggaaacaatagagacaag
cctcaaccttctgaaaatgaggtattggagagaagagtatccgcttctttcaatgaaagt
ggatcaacttccggcagggcgggggtagccgacataataagaaaccttgactataacagg
acaggaacagtttttaacgcctacgaaactctcgttaagatggctctgaaccacgacaat
cgcataaagccggaggatgttgtaatgaccaaagcaacatccaggtcttcacttccagtt
atacttgcacttgatgcaagcagatctatggaaaccatgaagagaatagcgatagcccgt
ggcattgcaagggactttttgaagtctgcatatagaatgagagtgaaaatgtcctatctc
acgttttctggctcagatacagctgtacgagtggaaatgacaagagatatcggaaggata
gaagaggagattatgcacactgtagcaaaagggaagactccactcccatctgcgctcaag
aagatgtacgaaatctcttcaaggtacagaaaacgcacagtatctattcttataacagat
ggcagggcaaacgtacccataaacaggtcagttgaagaggatttaagatactggtccaag
aaacttggcctaaaaagcgacctgttcctaatttcttctaccatgggaagcgaacaattt
atacctacctataacaatgacatatgcagctattctcgaggcaggctcatagagcttaac
agcaatggcgatttaagcattcactctggatacagaaaattttaa

DBGET integrated database retrieval system