KEGG   Thermoplasma volcanium: TVN0685Help
Entry
TVN0685           CDS       T00042                                 

Definition
Beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tvo  Thermoplasma volcanium
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TVN0685
  Lipid metabolism
   00600 Sphingolipid metabolism
    TVN0685
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVN0685
Enzymes [BR:tvo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TVN0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
689781..691226
Genome map
AA seq 481 aa AA seqDB search
MVENNFPEDFKFGWSQSGFQSEMGYDNAMDDKSDWYVWVHDKENIQSGLVSGDMPENGPG
YWNNYKSFHEAAQNMGLKMARIGVEWSRLFPEPFPEKIMADAKNNSLEINNNILSELDKY
VNKDALNHYIEIFNDIKNRNIDLIINMYHWPLPVWLSDPVSVRKGIKTERSGWLNDRIVQ
LFALFSSYIVYKMEDLAVAFSTMNEPNVVYGNGFINIKSGFPPSYLSSEFASKVKNNILK
AHSLAYDSMKKITDKPVGIIYANTYFTPLDPEKDNDAIAKADSDAKWSFFDPLIKGDKSL
GINGNKLDWIGINYYTRTMLRKDGDGYISLKGYGHSGSPNTVTNDKRPTSDIGWEFYPEG
LEYVIMNYWNRYKLPMYVTENGIADNGDYQRPYYLVSHIASVLRAINKGANVKGYLHWSL
VDNYEWALGFSPKFGLIGYDENKKLYWRPSALVYKEIATKNCISPELKHLDSIPPINGLR
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaacaattttccagaggatttcaaatttggttggtcacagtcaggttttcaa
tcggagatgggctatgataacgcaatggacgataaaagtgactggtatgtctgggttcat
gataaagaaaacatccaatcagggcttgtaagcggagacatgcccgaaaatggtccgggt
tactggaataactataaatcattccatgaagctgcacagaatatgggattaaaaatggca
agaatcggagttgaatggtcaagattattcccggaacctttcccggaaaaaataatggca
gatgcaaaaaataattccttagaaataaacaataacattctttcagaacttgataaatat
gtcaataaagatgcactcaaccattacattgagatatttaatgatatcaaaaatagaaat
atagatttaataattaatatgtaccactggccacttcctgtatggctaagcgatcctgta
tctgttagaaaaggaataaaaacagaaagatcaggctggctgaatgacaggatagttcaa
ttgtttgctttattctcctcgtatatagtatataaaatggaagatctggcagttgcattt
tcaaccatgaatgaacctaatgttgtttatggaaatggttttataaatatcaaatcaggt
tttccgccttcctatctcagttcagaatttgcatctaaagttaagaacaatatattaaaa
gcacattctcttgcatacgattctatgaaaaaaattacggataaacctgtgggaataatt
tatgcaaacacatattttacgcctttggatccggaaaaagataatgatgctattgctaaa
gcagacagtgatgcgaaatggtcattttttgatccattaataaaaggagataaatcactt
ggaattaatggcaataaactagattggatcggaattaattattatacaaggacaatgtta
aggaaagacggagatggctatatttcattaaaaggctatggtcattcaggttctcctaat
actgtaacaaacgataaaagaccaacaagtgatataggatgggaattctatccggaggga
ttggaatatgtaattatgaattactggaacaggtataaattgcctatgtacgtaacagaa
aatggcatagccgataatggggattatcagaggccttattatttagtttcacacattgca
agtgtactgagggcaataaataaaggagccaatgtaaagggttatttgcactggtcctta
gttgataattatgaatgggcattgggatttagcccgaaatttggtttaataggatacgat
gaaaataaaaaactatactggaggccaagtgctcttgtttataaggaaatagcaacaaaa
aattgcatatccccagaattaaagcacctcgattcaataccgcctataaatggtttaaga
aaataa

DBGET integrated database retrieval system