KEGG   Thermoplasma volcanium: TVN0728Help
Entry
TVN0728           CDS       T00042                                 

Definition
transcription regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVN0728
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVN0728
   00052 Galactose metabolism
    TVN0728
   00500 Starch and sucrose metabolism
    TVN0728
   00520 Amino sugar and nucleotide sugar metabolism
    TVN0728
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TVN0728
   00524 Butirosin and neomycin biosynthesis
    TVN0728
Enzymes [BR:tvo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TVN0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(742429..743376)
Genome map
AA seq 315 aa AA seqDB search
MALKILGYDVGGTKISTVVGNDNGNILSNVRMPTVKHLGKKRLIEEMITMGDAALKKAGV
DKPDMIGIIFAGPVDNKKGVVIASPNIFGLSNFNIVEPIQKYYGAKTYLENDATAAAIAE
RLFGSGKNVDNFVYMTLSTGIGGGIFINGKLYKGAHGMAGELGHSVIMVNGPTCGCGRRG
CLEALAGGKAIARRVIENLNAVRDSNFFSRIRPTEITAEKVFEGKKKGDMFSQLILEETI
YYLAVGIVNIINILDPELVIIGGGISKAGKDLFDPLNDAIREEFKSMYRPFKIVPGLENG
SDLAAISVPLYKESE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtggcattaaagattctaggctatgacgttggaggtacgaaaatttcaactgtggtcgga
aacgataacggaaatatactttcaaatgtgcgtatgccgactgtcaaacatcttgggaag
aaaaggcttattgaagaaatgataacgatgggtgatgctgcactcaaaaaagccggtgtt
gacaaaccagacatgatagggataatttttgccgggccggtagacaacaaaaagggagta
gttatagcttcccccaacatattcgggctaagcaacttcaatatcgtagaaccaatacaa
aagtattatggagctaaaacttacttggaaaacgatgctacagccgctgctatagctgaa
aggctttttggatctggaaagaacgtcgataattttgtgtatatgacgctcagtacgggc
attggaggcggcatattcataaacggaaaattatataaaggtgcccacggaatggcagga
gaattgggccatagtgttataatggtaaacggccctacttgcggatgcggaagaagaggc
tgcctagaagcccttgcaggaggcaaagctatagcaaggagggtcatagagaaccttaac
gctgtgagggattcgaatttcttctcaagaataaggccgacagagataacggctgaaaag
gtatttgaaggaaagaagaaaggtgatatgttttcacagttgattctcgaagaaacaata
tactatttagctgttggcatagtgaacatcataaacatacttgaccctgaattggttata
attggaggcggcatatcaaaggcaggcaaggatctcttcgatccgctgaatgatgcaatt
agagaagaatttaaaagcatgtacagaccattcaaaatagtgcccggattagagaatgga
tctgatcttgctgcaatatctgtgccactgtataaagagagcgaatga

DBGET integrated database retrieval system