KEGG   Thermoplasma volcanium: TVN0744Help
Entry
TVN0744           CDS       T00042                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tvo  Thermoplasma volcanium
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVN0744
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TVN0744
   00650 Butanoate metabolism
    TVN0744
  Energy metabolism
   00190 Oxidative phosphorylation
    TVN0744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(760262..760633)
Genome map
AA seq 123 aa AA seqDB search
MEKSSKVRYGALNRFVQAATGLFLVFFLGVHLYVAHINFGNPVALFGSVVNQLHNPWWLA
FFLIFVYIVTYHGINGLSHVIDDTSISDKSKKYIGIALMVIYVITIIYGTILAVLVSRMT
FPT
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagttctaaggtaagatacggggcactgaacagatttgtacaggcagctact
ggcctcttcctcgtgttcttcctcggtgtgcatctctatgttgcacatataaactttgga
aatcctgttgccctctttgggtcagttgtaaatcagctccataatccgtggtggctagca
ttctttttaatattcgtatacatcgttacttaccatggcataaatggtctttcccacgta
attgacgatacgagcataagcgataaatcaaagaaatacatagggatagcactaatggtg
atatacgttataacaataatttatggaacaatacttgctgttcttgtatcaaggatgact
tttccaacataa

DBGET integrated database retrieval system