KEGG   Thermoplasma volcanium: TVN0752Help
Entry
TVN0752           CDS       T00042                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TVN0752
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVN0752
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TVN0752
Enzymes [BR:tvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TVN0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(766521..767543)
Genome map
AA seq 340 aa AA seqDB search
MPCIVRCIRCGNVRKNEELRCPVCGNLYEIYPDFKFQDDYEKNFPYIKKWVSLGEVETPI
VNYGEVKFKIDYYQPTFSYKDRGSKVLISHIRDITPSQNISTISEDSSGNAGASIAAYGA
AAGLKVKVYVPKTVSGQKFKQILVYGAEAVKIDGNREDVQIAAENSGYYYASHVLRPEFR
DGIRSLAYEIFMQTEKMPDHIFIPVSAGTLLIGLYSGFEHLFRSGEIEKIPNIVAVQAEA
VSPVCAKLNGEQFDENSNATSIADALVSKKPILLEKMLSILRENGKCIRVSDNEIIEARK
ELALKGIYAEYSSSTVFAAYKKKKLENSLLVLTGAGLKND
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtatagttagatgcataaggtgcggtaatgtaagaaaaaacgaagaattgcgg
tgccctgtatgcgggaatctatatgaaatatatcctgactttaagtttcaagacgactat
gaaaaaaatttcccatacataaagaaatgggtttctctcggagaagttgagactcctatc
gtcaattacggcgaagtcaagttcaagattgattactaccagcctacattttcatataaa
gacagggggagcaaagttctgatctcacacataagggatattacgccatcgcagaatatt
tcaactatatctgaagattcatcagggaatgctggtgcatctattgcagcttatggagcg
gcagccggtcttaaagtaaaggtttacgtgcctaagactgtatccggccaaaagtttaaa
cagattcttgtctacggagccgaagctgttaaaatagatggcaatcgtgaagacgtacag
atagccgccgaaaattctggatattactatgcaagccatgtgctaagaccggaatttagg
gatggaatacgttccctcgcatatgaaatttttatgcagaccgaaaaaatgccagatcat
attttcataccagtttccgctggcaccttgcttattgggctttactcaggattcgaacac
ctattcaggtctggagaaatagagaaaatacccaatatcgtggcagttcaagccgaagct
gtatctccggtttgtgccaaactaaacggagaacaatttgatgaaaattctaatgcgaca
tccatagcagatgctctagtatcgaaaaagccaatcttattggaaaagatgctgtctata
ctaagagagaatggaaaatgcataagagtaagcgacaacgaaataatcgaagccagaaaa
gaattggcgttgaaaggcatttacgccgaatacagctcatccacagtatttgcagcttat
aaaaagaaaaaattagaaaatagcctacttgtacttactggggcggggctgaagaacgat
tga

DBGET integrated database retrieval system