KEGG   Thermoplasma volcanium: TVN0795Help
Entry
TVN0795           CDS       T00042                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tvo  Thermoplasma volcanium
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVN0795
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TVN0795
Enzymes [BR:tvo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TVN0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(808604..810415)
Genome map
AA seq 603 aa AA seqDB search
MIGGFTGKILRIDLSAGKLSIENTNMTWAKDYIGGQGLATRYYVEEVDPKIDPYDPENEL
IIAPGPLTGTSAPTAARYMAVTKSPLTGTITRSNSGGYFGAKLKHAGFDMIIFKGKSKKP
VYLYVDNGKAELRDASDLWGKDVFETTDILTSRISGNVSVACIGPAGENLVKFASIMNDK
HRAAGRNGVGAVMGSKNLKAIVAGGGRMPAIGDPEKYKIVLPKMLKKIKENPVTSQGLTQ
FGTEVLVNIINKSGIYSNKNLTESGDDPLADDVSGETLAETYLLHNQPCFACPIGCGRVV
RYNERESEGPEYESTWALGPNTGIHDLYTIIAANDNADRLGYDTISAGLTMSAAMELYEN
GKIPDKDVGPTKPKFGNQSALLEMSVKLAYRKDFGSKLAEGSKKLSEMYGDPSVSMSVKG
QEIAAYDPRGVWGMALEYATSNIGGSHMRAYTISNEILGVEPVSDPLKLEGKAELVKYVQ
DFTEVMDCSGLCQFPSFALNLDDYLELVNAVTGFNYTKEEIMKAAERVWNLERLFNLKAG
IKPEDDKLPERFLKDPIPKGPKKGNTVPFEKLIKDYYKVRGWTENGYPTPEKLKELGLEF
YGI
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgatagggggttttacaggtaaaattctgaggattgatctcagcgcgggtaagctttcc
atagagaatacaaatatgacgtgggcaaaggactacattggtgggcaaggccttgctact
cgttattatgtagaagaagttgatccaaagatcgatccttatgatcctgagaacgaactt
ataatagctcccggaccgctaactggcactagcgcacctacagcggcacggtatatggct
gttacgaaaagtccgcttactggtacaataacaagaagcaattcaggaggttacttcgga
gctaaattaaagcacgccggttttgatatgataatattcaaaggaaagtctaagaaacca
gtttatctctatgtagataacggaaaggccgagttgagagatgcatcagacctttgggga
aaagacgtcttcgaaactacagatatacttacgtcgagaataagcggaaacgtaagcgta
gcctgcatcggtccagcaggggaaaaccttgtgaaatttgcctccataatgaatgacaaa
catagagctgctggcagaaacggagtcggggcggttatgggctcaaagaaccttaaagca
atagttgccggtggcggaaggatgcctgccattggagatccagagaaatacaaaattgtg
ctgccgaaaatgcttaaaaaaatcaaagaaaaccctgttacctctcaaggtttaacacag
tttggtaccgaggttctagtaaatataatcaataaatccggcatatattcaaataagaat
ctaacggagtctggagacgaccctcttgcggatgatgtcagcggagagacgttagcagag
acctatctacttcacaaccagccgtgctttgcgtgtccgataggttgcgggagagtagtc
aggtataacgagcgggaaagtgaagggccggaatatgagagcacgtgggcccttggacca
aacacaggaattcatgacctttacactataatagccgcaaacgacaatgcagacaggctc
ggatatgacacaatatccgctggcctaacgatgtccgccgctatggaactctatgaaaat
gggaaaatacctgataaggatgtcggaccaacaaagccgaagttcggaaaccagagcgct
ttgctggagatgagtgtaaaacttgcctacaggaaggattttggatcgaagcttgcggaa
ggctcaaagaagctctcggaaatgtacggagatccatcagtttctatgagtgtaaagggg
caggagattgcagcatacgacccgagaggcgtgtggggcatggcgcttgagtatgcaacc
agcaacataggcggttcccacatgagagcttatacaatatcaaacgagattttaggtgtt
gagccagtatctgatcctctcaagttggaaggaaaggctgaactagttaagtacgtacag
gatttcactgaggtaatggactgttctgggctatgccagtttccctcatttgcactcaac
cttgatgattatttagaactagtaaacgcagttactggattcaactacactaaggaagaa
ataatgaaagctgcagaaagagtctggaacttggaaagattattcaacttaaaggcaggg
ataaaaccagaagacgataagctgcctgaaaggttcctaaaagatccaataccaaagggg
ccaaagaaagggaatacagtacctttcgagaaacttataaaagactattacaaggtaaga
ggatggaccgaaaatggttatccgactccagaaaaactaaaggagcttgggcttgaattt
tacggtatttaa

DBGET integrated database retrieval system