KEGG   Thermoplasma volcanium: TVN0835Help
Entry
TVN0835           CDS       T00042                                 

Definition
pyruvate:ferredoxin oxidoreductase, alpha subunit
Orthology
K00186  
2-oxoisovalerate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.7]
Organism
tvo  Thermoplasma volcanium
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TVN0835
Enzymes [BR:tvo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     TVN0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
870804..871982
Genome map
AA seq 392 aa AA seqDB search
MKSMQDYRTIMTGNDAVAYGAKLARVKLISAYPITPQTTIVEKLASMIANDELDAKYVKV
ESEHSALATVVSSELAGVRSYTATSSHGLLYMHEMLHWASGQRLPIVMSVVNRAIGPPWN
IWADQSDTMNQKDTGWMQVYCESNQEALDTIIMGYKIAENKDVLLPLMSMEDAFILSHTS
EPVTIRDQESVNEYLPDLDLPFKINEEHPMGYGSYDTPDGSFMELKKDMVDSMQKAKRII
EDETRKFNEMFGTEYGGLIEKYRMEDADYAIIATGTIASTARYVVDILRKKGEKVGLIRI
RYFRPFPYEEILSSLKYVKAAGVIDRSVSFSSGGPTYVEIVQGLYGKLNVPLSSFIAGIG
GRDVRIQDIENIYEMLKSGNSGTYWINVKEVR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctatgcaggattatcgaacaataatgacaggaaacgacgccgttgcttacggt
gcaaagcttgcaagagtcaaactgatctctgcatatccgataaccccgcagacgaccata
gtcgaaaagcttgcctctatgattgctaatgacgagctcgatgctaagtatgtgaaggtt
gaaagtgaacacagcgcacttgcaactgtagtttcctccgaactcgccggcgtaagatcc
tatactgccactagctctcacgggcttctatacatgcacgaaatgctgcactgggcatcc
ggccaaaggcttccaatagttatgagcgtagtcaacagggcaattggcccgccttggaac
atatgggcggatcaaagtgataccatgaaccaaaaggatacaggatggatgcaggtgtac
tgcgaatcaaaccaggaagccttagataccataataatgggatacaagatcgcagagaac
aaagatgtactgcttccgctcatgagtatggaagatgctttcattctctcgcatacatca
gagccggtaacgattagggatcaggagtctgtaaacgaatatctcccggacctcgatctg
ccatttaagataaacgaggagcacccaatgggctacggttcttatgatacgccagatggc
agctttatggagctcaaaaaggatatggtagattcaatgcaaaaggcaaaacgcataata
gaggatgaaacaaggaagttcaacgaaatgtttggtacggaatatggcgggttgattgaa
aagtataggatggaggacgctgattacgctatcatcgcaactggaactatagcatctacg
gcaaggtacgtcgtcgatattctaaggaaaaaaggggaaaaagtcggtctcataaggata
cgatacttcaggccgttcccctatgaagagatcttgtcatctctcaagtatgtaaaagct
gcaggcgtgatcgaccgttcagtttcattcagcagtggcggccctacttacgtcgagata
gtccagggcctatacggaaagctaaatgtgccattaagcagcttcatagctggaattggt
ggcagagacgtaaggattcaagacatagaaaatatttacgaaatgttgaagtcaggcaat
tccggcacatattggataaacgttaaggaggtgagataa

DBGET integrated database retrieval system