KEGG   Thermoplasma volcanium: TVN0924Help
Entry
TVN0924           CDS       T00042                                 

Definition
siroheme synthase
Orthology
K02304  
precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
tvo  Thermoplasma volcanium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TVN0924
Enzymes [BR:tvo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     TVN0924
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     TVN0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(976073..976717)
Genome map
AA seq 214 aa AA seqDB search
MIVDLRLSKSTSLFIGHGKEFRDKFELYHSEFGTVYVISDEVLLEDANVIRVSSSFEDSY
DAIESVKPFLAFISTEDRDLDTKLAYFARRHSKLVYVPDRNDLNDINLCAILQYGPIKIA
VSTSGKSPAMTVMVKKRIAASIKKYALIDNMDQSVVEAIARNREKIISSVKEPKKRRIMM
YRIAVDRRIREYSVLNPVMADEAIAKILNGAAGR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgatttacgtttgagtaagagtacttcactatttatcggccacggaaaagag
ttcagggataaattcgaattgtatcactctgaattcggcactgtatacgttatatcagac
gaagttcttttagaggatgcaaacgttattcgtgtgtcttcgagttttgaggatagttac
gatgccatcgagtctgtgaaacctttccttgcttttatatcaaccgaagatcgtgattta
gacacaaaattagcctatttcgctaggagacattcgaaacttgtttatgtgccggacagg
aacgacttaaatgatatcaacctatgcgccatacttcagtatgggcctattaagattgcg
gtgtccacgtctggtaagagcccagccatgaccgttatggtgaagaaaagaattgcagct
tctatcaaaaaatacgctttgatcgataatatggatcagtcagttgtagaagctatagcc
agaaacagggaaaagatcatatcatcagtgaaggagccaaaaaagagacgcataatgatg
tacagaattgctgttgataggcggattagagaatattctgttttaaaccctgtgatggct
gatgaggccattgcaaagatactaaatggtgcagcaggaagatga

DBGET integrated database retrieval system