KEGG   Thermoplasma volcanium: TVN0931Help
Entry
TVN0931           CDS       T00042                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TVN0931
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVN0931
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TVN0931
Enzymes [BR:tvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TVN0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
982485..983765
Genome map
AA seq 426 aa AA seqDB search
MIRIDLKQDDMPDHWYNILPDLPEELPTPRDETGEAFETLKKAVPTKVLEYEFSGERYPK
IPGEIYEKYMQVGRPTPIIRAKNLEEFLGGNIKIYLKMESYTYSGSHKINSALAHVFFAK
QDNAKFVSTETGAGQWGSAVALASALFGVDSHIFMVRTSFYAKPYRKYMMYMYGAHPHPS
PSEFTEYGKEVLKKNPDTPGSLGLAISEAIHYALDNGGKYIAGSVINSDILFKTIAGMEA
KKQMEMAGEDPDYVVGVVGGGSNYAALAFPFLADELQSGKVKRTYIASGSKEVPKMTEGE
YRYDYPDTGKVLPLLKMYTIGYDFIPPAVYAGGLRYHAVAPTLSLLMNKGIVQARDYDQE
EAFKWARIFSEKEGYIPAPETSHALPILKEIADSNRGEREKKTVLVSFSGHGLLDLGNYA
EAMHFE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgataagaatcgatctaaagcaagacgatatgccagaccattggtacaatattttgccc
gatcttccagaagagttgccaacaccaagggatgaaaccggcgaggccttcgaaacgctg
aagaaagcagtgcccacaaaggtactggaatatgagttttctggagaaaggtatccaaag
attccaggggagatctacgaaaaatatatgcaggtcggccggcctacgccaatcatcagg
gcaaagaatttagaagaattccttggtggcaatataaagatatacctaaagatggaatca
tacacgtattctggttcgcacaagataaatagtgcccttgcccatgtattcttcgccaag
caagataatgcaaaatttgtttcaacagagactggggctgggcaatggggatctgctgtt
gcgctcgcctcagcgttgtttggtgtcgattctcatatatttatggtacgtacaagcttc
tacgccaagccgtacagaaagtatatgatgtatatgtatggcgctcatcctcacccaagc
ccatcagaatttactgaatacggaaaggaagttttaaagaagaatcctgatacgccaggt
tcgttagggcttgcaataagtgaagcgatacattatgctctggataatggtggcaagtac
attgctggcagcgttataaattcagatatacttttcaaaactatagcgggaatggaggcc
aagaaacagatggaaatggcaggcgaagatccggactatgtagtcggagtagtaggtggc
ggttcgaactatgcagcacttgcattcccattcctagcagatgaacttcagtctggcaag
gtaaagaggacatacattgcatctggttcgaaagaggtgccaaagatgaccgagggagaa
tatcgatatgattatccagatacaggaaaagtcctccctctcttaaaaatgtacacgata
ggctatgactttataccgccagcggtctacgcaggcggccttaggtaccacgccgtagca
ccaacgttaagcctcctcatgaataagggaatagtacaagcgagggattacgatcaggaa
gaagccttcaaatgggccagaatattctcggaaaaggaaggatacatacctgcccccgaa
acttctcacgctttgccaatactaaaagagatagctgacagcaatcgcggtgaacgtgag
aaaaaaaccgttcttgtcagcttttctggccatggccttctagatctaggcaattatgca
gaggcaatgcattttgaataa

DBGET integrated database retrieval system