KEGG   Thermoplasma volcanium: TVN0979Help
Entry
TVN0979           CDS       T00042                                 

Definition
ribokinase sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tvo  Thermoplasma volcanium
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TVN0979
Enzymes [BR:tvo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TVN0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1030681..1031550
Genome map
AA seq 289 aa AA seqDB search
MAFLAYFGHLNIDVRILVENLPKEGSVNAKNVEEKYGGTAGNFAIVSKKLGLDFDIYSAV
GSKTHSGYLSFLKDSGIGIDHIKVTDEYGPICYIASDTKKQVAYMYQGPMLNWSPRLESH
YEYIHLSTGPKYTGLIENKESKLVFDPSQEIWKFSGEELKRFYEASYISFFNGNEMKVFR
EATGLKSFDRIVIETVGPRGSILYKDSTKKVFPALPSSGDTIGAGDAFRAGFYYALFRKK
SIETAMVYGTIAAHHMIEDGIDGFSLDANSIEQESQVYKKTFGIQSTSL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggctttccttgcctatttcggacaccttaacatagacgtgcgtatactagtcgaaaac
ctgccaaaggaaggatctgttaatgcgaaaaatgtggaagaaaaatatggtggcactgct
ggaaactttgcaattgtatcaaagaagcttgggctcgactttgatatatactcagcggtt
gggtcaaagactcattccggctatttgtcgttccttaaggactctggcatcgggatagac
catattaaagtaactgatgaatacggcccgatatgctatattgccagtgataccaagaag
caggtagcttatatgtatcagggtccgatgttgaactggtctccacgtttggaaagccat
tacgaatacattcacctcagtactggcccaaaatatacaggtttaatagaaaataaagaa
tcgaagttggtatttgatccctcgcaagagatatggaagttttccggtgaagagcttaag
agattttacgaagcttcgtatatttcattcttcaacggaaatgaaatgaaggtgtttcga
gaagcgactggcttaaaaagcttcgataggatcgtcatagaaacggttggtcctcgcgga
tctatactatacaaggattctacaaagaaggtcttccctgcacttccatccagcggcgat
actataggcgccggagatgcgttcagggccggattctactacgctctattcaggaaaaaa
agcatagaaactgcaatggtgtacggtacaatagcggctcaccatatgattgaggatggt
atagacggtttttctttagacgccaatagtattgaacaagaatcgcaggtatataagaag
acattcggaattcagagcacatcactctaa

DBGET integrated database retrieval system