KEGG   Thermoplasma volcanium: TVN1027Help
Entry
TVN1027           CDS       T00042                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TVN1027
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVN1027
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TVN1027
Enzymes [BR:tvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TVN1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1081798..1082511)
Genome map
AA seq 237 aa AA seqDB search
MKPFVYFTLGYKYNEVKKFIKNSDGVYAFEFGFPTENPLYDGKKIKATHSFAVNKFSHDD
NAEIFKLAESMGIKKYALLYYSVFSGKKGILDYLSSSRFDGVMVPDVGIDYPDRIEQVAK
AIADHGMDYVPFVTPVTPFKIMERQMKVSGEIVYQGMMPATGIQLPYDIGTIYGHIRDFT
SGKRIVYGFGIRNKCTIAKIAKYGGFGIAVGTAVVEMLDDGNVKAYRQLINDILGAS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaagccatttgtatatttcactctcggttacaaatacaatgaggtaaaaaaattcata
aagaattcagatggagtatatgcctttgaatttggctttccaactgagaatccactctat
gacgggaagaaaataaaagctacacatagttttgcagtcaacaaatttagccatgatgat
aatgcagaaatattcaagcttgcagaatctatgggcattaaaaagtatgccctcctgtac
tattctgtcttttcagggaagaagggaatcctggattacttatcgtcatcaagatttgac
ggggttatggtgcctgacgttggcatagactatccggatagaatagaacaagtagccaag
gcaatagcggatcatggaatggattacgtaccgttcgtcactcccgtcactccattcaag
ataatggaaaggcagatgaaagtaagcggggagatcgtctatcaagggatgatgccagca
accggcattcagctgccttatgatatagggactatttatgggcacatcagggattttaca
tctggaaagcgtatagtttacggatttggcatacgtaacaagtgtacgatagctaagatc
gccaagtacggtgggttcggaatagcggtaggtacagctgttgtagaaatgctggacgat
ggcaatgtgaaggcctacaggcagctgatcaatgatattttgggggcatcctaa

DBGET integrated database retrieval system