KEGG   Thermoplasma volcanium: TVN1027Help
Entry
TVN1027           CDS       T00042                                 

Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TVN1027
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVN1027
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TVN1027
Enzymes [BR:tvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TVN1027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1081798..1082511)
Genome map
AA seq 237 aa AA seqDB search
MKPFVYFTLGYKYNEVKKFIKNSDGVYAFEFGFPTENPLYDGKKIKATHSFAVNKFSHDD
NAEIFKLAESMGIKKYALLYYSVFSGKKGILDYLSSSRFDGVMVPDVGIDYPDRIEQVAK
AIADHGMDYVPFVTPVTPFKIMERQMKVSGEIVYQGMMPATGIQLPYDIGTIYGHIRDFT
SGKRIVYGFGIRNKCTIAKIAKYGGFGIAVGTAVVEMLDDGNVKAYRQLINDILGAS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaagccatttgtatatttcactctcggttacaaatacaatgaggtaaaaaaattcata
aagaattcagatggagtatatgcctttgaatttggctttccaactgagaatccactctat
gacgggaagaaaataaaagctacacatagttttgcagtcaacaaatttagccatgatgat
aatgcagaaatattcaagcttgcagaatctatgggcattaaaaagtatgccctcctgtac
tattctgtcttttcagggaagaagggaatcctggattacttatcgtcatcaagatttgac
ggggttatggtgcctgacgttggcatagactatccggatagaatagaacaagtagccaag
gcaatagcggatcatggaatggattacgtaccgttcgtcactcccgtcactccattcaag
ataatggaaaggcagatgaaagtaagcggggagatcgtctatcaagggatgatgccagca
accggcattcagctgccttatgatatagggactatttatgggcacatcagggattttaca
tctggaaagcgtatagtttacggatttggcatacgtaacaagtgtacgatagctaagatc
gccaagtacggtgggttcggaatagcggtaggtacagctgttgtagaaatgctggacgat
ggcaatgtgaaggcctacaggcagctgatcaatgatattttgggggcatcctaa

DBGET integrated database retrieval system