KEGG   Thermoplasma volcanium: TVN1141Help
Entry
TVN1141           CDS       T00042                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TVN1141
Enzymes [BR:tvo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TVN1141
Exosome [BR:tvo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVN1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1192129..1193625)
Genome map
AA seq 498 aa AA seqDB search
MARRPIDSDDIFLALDAGTTDVKAGAYDRSMNLIASCKRRIGVYYGQGGVVEQDPHEILE
AAKYCLNSILRRIPKRYGEPKAIGITNQRESVLAWEPIDGRPITKLISWKDKRGAQLSLD
LKERYGQVIKDKTGLISDPYFSATKIKWLVENIKRSSNHKNYVITTLDSWLVKNLNSSSI
KPLTDHSNASRTMLFNIDSLEWDSDLLEIVGISEEILPEVKRTIESDSYGKVKLTYGSTT
REVPILSVAGDQQASLFGNGCLYPGQAKASYGTGAFILENTGVRVKSDRLLETLFYTYKG
KRTYALEGTILSSGSSIDWLVSLAGLKSVPRSILRAEQIERSHVLSVPALSGLGSPFYSS
DIRGYISGLSESTDIYEVIRSFLEAQAFLSTVIIEEMRKHIKLLEPLHIDGGLSKSDLIA
EMLANLLDMKIIRERNVDATMKGIAMMSMIGYYGIDERKLTVSAGGKEFNPNDKRDEIAE
KFNSWRSFLLSVISKNQG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctagaagaccgattgatagtgacgatattttcctcgcacttgatgcgggtactaca
gacgttaaggcaggagcatatgatcgatcgatgaacctaatcgcttcatgcaaaaggaga
ataggggtatattatggccaaggcggtgtagttgaacaggatccacatgaaatactcgaa
gctgctaaatactgcctaaactcaatcttaaggcgcataccgaaaagatacggggaacca
aaggcaatcggtattacaaaccagagggaaagcgtcttggcctgggaacctattgatgga
aggccgatcactaaactaataagctggaaggacaaaagaggagcccagttatctcttgat
ctgaaagagcgttatggtcaagtgataaaggataagacaggcttaataagcgatccctac
ttttccgccacaaaaataaagtggttggtcgaaaatattaaacggagctctaaccataaa
aactacgttattacaacactggattcatggttggtcaaaaatcttaattcgagttcgatt
aaacctttaacggatcattccaacgcgtctagaactatgcttttcaatatagattcattg
gaatgggatagcgatcttctcgaaattgtaggtataagtgaagaaatcctgccggaggta
aaacggacaattgagtcagattcatatggaaaagtgaaattgacctacggttcaactaca
cgtgaagttccaatattatctgttgctggcgaccagcaagcttcgctttttgggaatggc
tgcctttatccaggtcaagccaaagcaagttatggaactggtgcatttattttggaaaac
acgggagttagagtaaaatcggatcgtctattggagacgctattttacacatacaagggc
aagaggacatacgctctagaaggaacaatcctttcttctggttcctcaatagattggcta
gtttccctcgctgggcttaagagcgtgccaagatccatattgagagcggaacaaatcgaa
aggagtcatgttttatcagtgccagcattatcaggcttagggtcgccattttattctagc
gacataaggggatacatttctgggctatcagaatcaacggatatatatgaagtaataagg
tcttttctagaggcgcaggcgtttcttagtacggtgatcattgaagaaatgaggaaacat
attaaactattagaaccgctgcacattgatggcggcctatcgaaaagtgacttaatagca
gagatgcttgctaatttgcttgatatgaagataatacgcgaaaggaatgttgatgccacc
atgaaaggcatagcaatgatgtctatgatcggctattacggtatcgatgaacggaaatta
acggtcagtgctggaggcaaagaatttaaccctaatgacaagagggacgaaatagctgaa
aaatttaattcttggcgttcattccttctttctgtgatatccaaaaaccaaggttaa

DBGET integrated database retrieval system