KEGG   Thermoplasma volcanium: TVN1266Help
Entry
TVN1266           CDS       T00042                                 

Definition
(RefSeq) acyl-CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVN1266
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVN1266
   00620 Pyruvate metabolism
    TVN1266
   00640 Propanoate metabolism
    TVN1266
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TVN1266
   00680 Methane metabolism
    TVN1266
Enzymes [BR:tvo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TVN1266
Lipid biosynthesis proteins [BR:tvo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TVN1266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1328971..1330911)
Genome map
AA seq 646 aa AA seqDB search
MLVNAMTYDLPNFVLNSKEILRIDEKKRDEFKRLLEFSKNDPNGFWESIASDLVWRKKWD
TVMEGRLPEFSFFKGGYLNVAENLIDRHIEAGEANRAALIFESETGRSAVYTYAMLQSIV
NKLSNALRSLGVKKGDRVSIFLPNIPETLFSVLACYRVGAVFNTIFSGFSTQALENRLKH
FNPMIIITADGTYRRGKLVELKKKVDEIRDSNFEKIIVVKNVGLNLNFTERDLDFYSLIA
KFNDKDKGGDVEANEPGIVFYTSGTTGKPKGVVLSGAGFLVNNYVYAKHHLDLSKSDVLW
CTADIGWLTMHIWGIIGALANGSTTLFYEGAIDYPSQDRFYEIVQKYKVTKIFTAPTLIR
MLMKYGFPEGKYDVSSVRVIGLVGEPLNPEAWHWMNKHFRSAYINNTWGQTETAGTPLAG
SAFATGMKPGSSGIEFLGASLDVVDDEGNPVLERPGNLVIKKPFPMMIRDLWNEHERFLK
EYYGKLEGLYFTYDVAVKDKDGHFWVLGRNDDVINVSGHRLSTMEMESLVASVNGIAECA
VVGIPDEIRGLTPVVFVSLKNDISATGIEETISKMIEEGIGKFAAPSDVIVVEEMPKTPS
GKILRRFLREIYVYGDIVGDRTGLENPASIEKLKSVLRNRIESRNK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgttagtaaatgccatgacatatgatctaccgaattttgttttaaatagtaaggagatc
cttagaatagacgagaagaaaagggatgaatttaagcgtttgcttgaattctcgaagaac
gatccaaatggcttttgggagagtattgcttctgatctagtttggagaaagaaatgggat
accgtaatggaaggcagacttcctgaattttcctttttcaagggaggctatttaaacgtt
gctgaaaacctcatagatagacatatagaagctggggaagctaatagagctgctttgata
tttgagagcgaaacagggcgaagcgctgtatatacatacgcaatgctgcaatctattgta
aacaaactttcaaatgctctaagaagcctaggcgtaaagaaaggtgacagagtctctata
tttctgccaaacatacctgaaacattattcagtgtgctcgcgtgctacagggttggtgct
gttttcaatacaatattttctggtttctctacgcaggcattggagaacaggttaaagcat
tttaaccctatgataataataactgcagacggaacatacagaagaggcaaactagtggag
ttaaagaaaaaagtggatgagattcgagattctaattttgaaaagatcatcgtagtaaaa
aatgtagggctcaatctgaattttacagaaagagatttagacttttacagcctaatagcg
aagtttaacgataaagacaaagggggagatgtcgaggcaaacgagcctggcatagtcttt
tatacatcaggtacaacaggtaagccaaaaggagtggtgctttcgggtgccggatttctg
gtgaacaactacgtgtatgcaaagcaccacctcgatttgagtaaatctgatgtactttgg
tgcacagctgacataggatggcttactatgcatatatggggtataattggggctcttgct
aatggctctacgactctattttatgaaggggcaatcgattacccttctcaagatcgtttc
tacgaaatagtgcaaaaatacaaagtaacaaaaattttcacagctccaactttgataagg
atgctgatgaagtacggctttccagagggcaagtatgatgtttcatccgttcgtgtaata
ggactagtgggcgagccgttgaatccagaagcgtggcactggatgaataaacacttcaga
tctgcatacattaataatacgtgggggcaaaccgaaactgctggaactccgcttgcagga
tctgcctttgctactggcatgaagccaggatctagcggcatcgagttcctgggagcatcc
ttggatgttgttgacgatgagggtaatccagtgcttgaacgtccaggaaatttagtaata
aagaaaccgttccctatgatgatccgcgatctatggaacgaacacgaacgtttcttaaaa
gaatactatggaaagttagaaggattgtatttcacctatgatgttgctgtaaaggataaa
gatggccacttttgggttctcgggaggaatgatgatgtaatcaacgtttccggccataga
ctgagcacgatggagatggagagccttgtagctagcgtaaacggaatagctgaatgtgca
gttgtaggaatccctgatgaaatcagaggtctcactcccgttgtattcgtttcattgaag
aatgatatatcagcgacaggcattgaagaaactatatcaaagatgattgaggagggcatt
gggaagtttgcagcaccgtccgatgtaatcgttgttgaagagatgccgaagaccccaagt
ggaaaaatactcagaaggttccttagggagatctatgtttatggagacattgtcggagac
cgtaccggccttgaaaatccggcgtctatagaaaaattgaaatcagtattgcgaaataga
atagaaagtaggaataagtga

DBGET integrated database retrieval system