KEGG   Thermoplasma volcanium: TVN1268Help
Entry
TVN1268           CDS       T00042                                 

Definition
acyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tvo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tvo00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tvo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tvo00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:tvo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1331499..1333358)
Genome map
AA seq 619 aa AA seqDB search
MFVYKPDEAEIASTNLGMFASSVGITVKELYDKADSDPEWFWPQVIKDTGIEFFSPYKKV
FDNSGGPQHTKWFTEGLINIEYNAVSRYKDSSKPAVIYQNEYLERETLSYSGLNIYVSSV
ASTLLDMGIRKGDRVGIYMPFNLKSAIAFYSILRIGAVAVPMFSGYGYEAVKTRVEDAGV
KLLFTSKGYSRKGKFVDMMSVAEKVGLPIIAEGGSKKGYSFEDAMHGQKRIETEKTGSED
TAIMLYTSGTTGKPKGTVHVHGGALINIAKEVKYYMDLKDGDVLHWITDLGWMMGPWALI
GTNVLHGTIYLYDGAVDYPDASRLFTILEDNNVTLLGLSPTLVRMLRYKNIERRFNTVRL
FGSTGEPWDDESWSYLFNVLGGGKTPISNISGGTDIIGCFLASNPAIPIKPKCLYRGLGM
NASIFDENGKEVYGKVGYLVAKKPSPSMTRGLWMAEDRYLESYWSRFQGVWFHGDFGEMD
EDGYFYLYGRADDVIKVAGKRVGPNELEDIVMAVNGVIEAAVISIPDKIKGEALAVFYVG
EPDLSGRIKDAIESKMGKPFSPSYVLRLRKLPKTRNGKTMRRVIRSSFLGQDPGDLSNTE
DLDSIKEIEELGRTIFNND
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtttataagcctgatgaagcggagatagcatcaacgaatttggggatgtttgct
tcttctgttggaatcactgtaaaggaactctacgataaagcagattcagacccagaatgg
ttttggcctcaggtgattaaagatactggaattgaattcttttctccatacaaaaaagtt
tttgacaattcaggcgggccgcaacatacgaaatggtttactgaaggactcataaacata
gagtataacgcagtctcaaggtataaggattcgtcaaagcctgcagtaatttaccagaat
gaatatctcgaaagggaaacgctttcctattccggactcaatatatatgtatcttctgtt
gcctctactcttcttgatatggggatacggaaaggcgatagggttggcatctacatgcct
tttaacttaaagagtgcaatcgctttctattccatacttcgaattggagcagtagccgtt
cctatgttctcaggatacggctatgaagctgtaaaaacacgcgttgaagatgctggagtg
aagcttctctttacatccaaaggatactccagaaaaggaaaatttgtcgacatgatgtct
gtagccgagaaggttggcttgcccataatagctgaaggcggtagcaaaaaaggctatagt
ttcgaagatgctatgcatgggcagaagcggatagagacggagaaaacgggatcggaagac
acagccataatgctttatacatctgggacaacaggaaagcctaagggaactgtacacgtc
cacggtggagccttgattaacatagccaaagaggtgaagtactatatggacttgaaggac
ggtgacgtgcttcactggataaccgatcttgggtggatgatgggcccgtgggccttaata
ggtacgaatgtactgcacgggacgatttatctgtatgacggtgctgtagattatccggat
gcctctagactcttcaccatacttgaagataacaacgttacactgcttggtctatcgcca
actctcgttcgcatgctgaggtataaaaatattgagagaagattcaatacagtaaggctc
tttggatctaccggcgaaccttgggacgacgagtcgtggagctacttgttcaatgttctt
ggtggaggcaaaacgcctatttcgaatatctctggaggcactgacattatcggctgcttc
cttgcatcgaacccggcaataccgattaaaccgaaatgcctctaccgcgggctcggaatg
aacgcatccatatttgacgaaaacggaaaagaggtctatggaaaggtcggttatcttgta
gcaaagaagccatcaccttctatgacgcggggtttgtggatggcagaggaccgctacctc
gaaagctattggtctagatttcagggtgtttggtttcacggcgactttggagaaatggat
gaagatggctatttttatctctatggaagggcggacgatgtgataaaggtagctggcaaa
agggtcgggcccaacgaattggaagatattgtaatggcagtgaacggcgttatagaggca
gctgtaatttccataccagataaaataaagggtgaagctctcgctgtgttttacgttggc
gaaccggatctatcaggtaggataaaagacgctatagaatctaagatgggaaagccattc
tcgccgtcctatgtgctgcgattgagaaaactgccaaagacgaggaatggcaagaccatg
aggcgtgttataagatcctcattccttggccaagaccccggagacttgagcaacactgaa
gacctagattccattaaagaaatagaagaactcggaaggaccatattcaacaacgattga

DBGET integrated database retrieval system